NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22579.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22579.1 Public Mus musculus 8 Dync1li2 21 106 86 CCDS HistoryNCBI Gene:234663Re-query CCDS DB by CCDS ID:22579.1Re-query CCDS DB by GeneID:234663See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22579.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000041769 ENSMUSP00000045480 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041769Link to Ensembl Protein Viewer:ENSMUSP00000045480Re-query CCDS DB by Nucleotide ID:ENSMUST00000041769Re-query CCDS DB by Protein ID:ENSMUSP00000045480
Original member Current member EBI,WTSI OTTMUST00000151091 OTTMUSP00000078357 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000151091Link to Vega Protein Viewer:OTTMUSP00000078357Re-query CCDS DB by Nucleotide ID:OTTMUST00000151091Re-query CCDS DB by Protein ID:OTTMUSP00000078357
Original member Current member NCBI NM_001013380.2 NP_001013398.2 Accepted alive Link to Nucleotide Sequence:NM_001013380.2Link to Protein Sequence:NP_001013398.2Re-query CCDS DB by Nucleotide ID:NM_001013380Re-query CCDS DB by Protein ID:NP_001013398Link to BLink:NP_001013398.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001013398.2 492 Q6PDL0 492 100% 0 0

Chromosomal Locations for CCDS 22579.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 104420582 104420682 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 104422287 104422403 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 104423113 104423230 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 104423586 104423627 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 104425439 104425498 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 104425959 104426070 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 104428046 104428181 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 104429415 104429508 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 104430401 104430570 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 104437363 104437593 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 104440474 104440590 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 104442474 104442547 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 104442695 104442801 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1479 nt):
ATGGCGCCGGTGGGGGTGGAGAAGAAGCTGCTGCTGGGTCCCAACGGGCCCGCAGTGGCGGCCGCCGGCG
AC
CTGACAAGTGAAGAGGAGGAAGGCCAGAGTCTATGGTCTTCGATCTTGAGCGAAGTGTCCACCCGTGC
C
AGGTCCAAGCTGCCGTCCGGCAAAAACATTCTGGTGTTCGGTGAAGATGGTTCTGGTAAGACAACTCTC
ATG
ACCAAACTCCAAGGAGCAGAACACGGCAAAAAAGGAAGAGGCTTAGAGTATCTTTACCTCAGCGTTC
AT
GATGAGGACCGGGACGATCACACACGCTGCAATGTGTGGATTTTAGATGGAGACCTCTACCATAAAGG
C
CTGCTGAAATTTGCAGTTTCAGCTGAGTCTCTGCGGGAGACCCTGGTCATTTTTGTTGCCGACATGTCT
CGA
CCTTGGACGATAATGGAGTCTCTGCAGAAGTGGGCTAGTGTTTTACGGGAGCACATTGACAAGATGA
AG
ATTCCACCGGAGGAGATGCGGGATCTGGAACGGAAATTTATGAAAGAGTTTCAAGATTATATCGAGCC
T
GAAGAAGGTTGTCAGGGTTCCCCACAGAGAAGAGGGCCTCTGACCTCAGGCTCAGACGAAGACAGTGTT
GCC
CTCCCTCTGGGTGACAACGTGCTGACTCATAACCTGGGGATCCCAGTGTTGGTGGTGTGCACAAAGT
GT
GATGCCATGAGCGTCTTGGAGAAGGAGCACGATTACAGGGACGAGCACCTGGACTTCATCCAGGCGCA
C
CTGCGGAGATTCTGCCTCCAGTATGGAGCAGCCTTGATTTACACCTCAGTGAAGGAAGAGAAAAACCTT
GAC
TTGCTGTATAAGTACATTGTTCATAAAACCTATGGCTTCCACTTTACCATACCCGCCTTAGTTGTGG
AA
AAGGACGCGGTTTTTATACCTGCAGGCTGGGACAATGAAAAGAAAATAGCTATTTTACATGAAAATTT
T
ACAACCGTGAAGCCAGAAGACGCGTATGAAGATTTTATTGTAAAGCCGCCTGTGAGAAAGCTGGTCCAT
GAC
AAAGAGTTGGCAGCGGAGGATGAGCAGGTGTTCCTAATGAAGCAACAGTCACTCCTTGCCAAGCAGC
CT
GCCACGCCCACAAGAACCTCCGAATCCCCTGCCAGAGGACCCTCTGGCTCTCCAAGGACGCAGGGTCG
G
GGTGGACCAGCTAGTGTACCAAGTGCCTCCCCCGGAACTTCAGTAAAGAAGCCAGATCCAAACATCAAA
A
AT
AATGCGGCAAGTGAAGGGGTATTGGCCAGCTTCTTCAATAGTCTGTTGAGTAAAAAAACAGGCTCTC
CC
GGAAGTCCTAGTGCTGGTGGAGTGCAGAGCACAGCCAAGAAGTCAGGACAAAAGACTGTGTTGTCAAA
T
GTTCAGGAAGAACTGGATAGAATGACTCGAAAGCCAGACTCCATGGTAACAAACTCTTCAACAGAAAAT
GAA
GCCTGA


Translation (492 aa):
MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVFGEDGSGKTTL
M
TKLQGAEHGKKGRGLEYLYLSVHDEDRD
DHTRCNVWILDGDLYHKGLLKFAVSAESLRETLVIFVADMS
R
PWTIMESLQKWASVLREHIDKMKIPPEEMRDLERK
FMKEFQDYIEPEEGCQGSPQRRGPLTSGSDEDSV
A
LPLGDNVLTHNLGIPVLVVCTK
CDAMSVLEKEHDYRDEHLDFIQAHLRRFCLQYGAALIYTSVKEEKNL
D
LLYKYIVHKTYGFHFTIPALVVEKDAVF
IPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVH
D
KELAAEDEQVFLMKQQ
SLLAKQPATPTRTSESPARGPSGSPRTQGRGGPASVPSASPGTSVKKPDPNIK
N
NAASEGVLASFFNSLLSKKTGSPGSPSAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTEN
E
A




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser