NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS22017.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22017.1 Public Mus musculus 7 Cd151 23 108 98 CCDS HistoryNCBI Gene:12476Re-query CCDS DB by CCDS ID:22017.1Re-query CCDS DB by GeneID:12476See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22017.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000058746.6 ENSMUSP00000061636.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000058746.6Link to Ensembl Protein Viewer:ENSMUSP00000061636.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000058746Re-query CCDS DB by Protein ID:ENSMUSP00000061636
Original member Current member EBI ENSMUST00000106000.9 ENSMUSP00000101622.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106000.9Link to Ensembl Protein Viewer:ENSMUSP00000101622.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000106000Re-query CCDS DB by Protein ID:ENSMUSP00000101622
Original member Current member EBI ENSMUST00000177840.8 ENSMUSP00000136331.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000177840.8Link to Ensembl Protein Viewer:ENSMUSP00000136331.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000177840Re-query CCDS DB by Protein ID:ENSMUSP00000136331
Original member Current member NCBI NM_001111049.1 NP_001104519.1 Accepted alive Link to Nucleotide Sequence:NM_001111049.1Link to Protein Sequence:NP_001104519.1Re-query CCDS DB by Nucleotide ID:NM_001111049Re-query CCDS DB by Protein ID:NP_001104519Link to BLAST:NP_001104519.1
Original member Current member NCBI NM_001111050.1 NP_001104520.1 Accepted alive Link to Nucleotide Sequence:NM_001111050.1Link to Protein Sequence:NP_001104520.1Re-query CCDS DB by Nucleotide ID:NM_001111050Re-query CCDS DB by Protein ID:NP_001104520Link to BLAST:NP_001104520.1
Original member Current member NCBI NM_009842.3 NP_033972.2 Accepted alive Link to Nucleotide Sequence:NM_009842.3Link to Protein Sequence:NP_033972.2Re-query CCDS DB by Nucleotide ID:NM_009842Re-query CCDS DB by Protein ID:NP_033972Link to BLAST:NP_033972.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001104519.1 253 O35566 253 100% 0 0
NP_001104520.1 253 O35566 253 100% 0 0
NP_033972.2 253 O35566 253 100% 0 0

Chromosomal Locations for CCDS 22017.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 141469262 141469345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 141469466 141469657 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 141469937 141470011 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 141470121 141470225 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 141470310 141470468 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 141470551 141470697 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (762 nt):
ATGGGTGAATTCAATGAGAAGAAGGCAACATGTGGCACAGTCTGCCTCAAGTACCTGCTCTTTACCTACA
AC
TGCTGCTTCTGGCTGGCCGGCCTGGCTGTCATGGCAGTGGGCATCTGGACACTGGCCCTCAAGAGTGA
C
TACATTAGTCTGCTGGCCTCAAGCACTTACCTAGCCACGGCCTACATCTTAGTGGTGGCTGGTGTTGTT
GTC
ATGGTGACTGGAGTCCTGGGCTGCTGTGCCACTTTCAAGGAGCGACGGAACCTGTTACGCTTGTACT
TC
ATCCTGCTCCTCATCATCTTCCTCCTGGAGATCATTGCTGGCATCCTGGCCTATGTCTATTATCAGCA
G
CTGAACACAGAGCTCAAGGAGAATCTGAAGGACACCATGGTCAAGAGATACCACCAGTCAGGCCACGAG
GGT
GTGAGCAGCGCTGTCGACAAGCTGCAGCAAGAGTTCCACTGTTGTGGCAGCAACAACTCTCAAGACT
GG
CAAGACAGCGAGTGGATCCGCTCTGGTGAGGCAGACAGCCGCGTGGTTCCTGACAGCTGCTGTAAGAC
T
ATGGTAGCTGGCTGTGGTAAGCGGGACCATGCCTCCAACATCTATAAAGTGGAGGGTGGCTGTATCACT
AAG
CTGGAGACCTTCATTCAGGAGCACCTGCGGGTCATTGGGGCGGTGGGCATTGGCATCGCCTGTGTGC
AG
GTCTTCGGCATGATCTTCACCTGCTGCTTGTACCGAAGCCTCAAGCTGGAACACTACTGA


Translation (253 aa):
MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLATAYILVVAGVV
V
MVTGVLGCCATFKERRNLLRL
YFILLLIIFLLEIIAGILAYVYYQQLNTELKENLKDTMVKRYHQSGHE
G
VSSAVDKLQQE
FHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAGCGKRDHASNIYKVEGGCIT
K
LETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser