NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21945.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21945.1 Public Mus musculus 7 Mgmt 21 106 86 CCDS HistoryNCBI Gene:17314Re-query CCDS DB by CCDS ID:21945.1Re-query CCDS DB by GeneID:17314See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21945.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000081510 ENSMUSP00000080224 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000081510Link to Ensembl Protein Viewer:ENSMUSP00000080224Re-query CCDS DB by Nucleotide ID:ENSMUST00000081510Re-query CCDS DB by Protein ID:ENSMUSP00000080224
Original member Current member EBI,WTSI OTTMUST00000147589 OTTMUSP00000076809 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000147589Link to Vega Protein Viewer:OTTMUSP00000076809Re-query CCDS DB by Nucleotide ID:OTTMUST00000147589Re-query CCDS DB by Protein ID:OTTMUSP00000076809
Original member Current member NCBI NM_008598.2 NP_032624.1 Accepted alive Link to Nucleotide Sequence:NM_008598.2Link to Protein Sequence:NP_032624.1Re-query CCDS DB by Nucleotide ID:NM_008598Re-query CCDS DB by Protein ID:NP_032624Link to BLAST:NP_032624.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032624.1 211 P26187 211 100% 0 0

Chromosomal Locations for CCDS 21945.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 136951280 136951404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 137085949 137086109 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 137121489 137121628 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 137127885 137128094 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (636 nt):
ATGGCTGAGACCTGCAAAATGAAATACTCAGTGTTGGACAGCCCTTTGGGGAAGATGGAGCTGTCTGGCT
GT
GAGCGAGGCCTGCATGGGATACGGTTGCTCAGTGGGAAGACCCCAAACACTGACCCCACAGAGGCCCC
A
GCTACTCCTGAGGTGCTCGGTGGGCCAGAGGGAGTTCCAGAGCCTCTGGTGCAGTGCACAGCCTGGCTG
GAA
GCCTATTTCCGTGAACCCGCAGCCACAGAGGGGCTTCCCTTGCCTGCTCTCCATCACCCTGTGTTCC
AG
CAAGATTCATTCACCAGACAGGTGTTATGGAAGCTGCTGAAGGTTGTGAAATTCGGAGAAACGGTTTC
T
TACCAGCAATTAGCAGCCCTGGCAGGCAACCCCAAAGCGGCTCGTGCAGTAGGAGGAGCAATGAGAAGC
AAT
CCGGTCCCCATCCTCATCCCCTGCCACAGGGTGGTTCGCAGTGACGGTGCCATCGGCCATTACTCCG
GA
GGAGGGCAGGCTGTGAAGGAGTGGCTTCTGGCCCATGAGGGCATCCCGACCGGACAGCCAGCCTCCAA
G
GGCTTGGGTCTGACTGGGACCTGGCTCAAGTCATCCTTCGAGTCGACCAGCTCTGAGCCGTCTGGCCGA
AAT
TGA


Translation (211 aa):
MAETCKMKYSVLDSPLGKMELSGCERGLHGIRLLSGKTPNTDPTEAPATPEVLGGPEGVPEPLVQCTAWL
E
AYFREPAATEGLPLPALHHPVFQQ
DSFTRQVLWKLLKVVKFGETVSYQQLAALAGNPKAARAVGGAMRS
N
P
VPILIPCHRVVRSDGAIGHYSGGGQAVKEWLLAHEGIPTGQPASKGLGLTGTWLKSSFESTSSEPSGR
N




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser