NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21881.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21881.1 Public Mus musculus 7 Zfp668 23 108 98 CCDS HistoryNCBI Gene:244219Re-query CCDS DB by CCDS ID:21881.1Re-query CCDS DB by GeneID:244219See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21881.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000054415.11 ENSMUSP00000056105.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000054415.11Link to Ensembl Protein Viewer:ENSMUSP00000056105.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000054415Re-query CCDS DB by Protein ID:ENSMUSP00000056105
Original member Current member EBI,WTSI ENSMUST00000106261.7 ENSMUSP00000101868.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106261.7Link to Ensembl Protein Viewer:ENSMUSP00000101868.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000106261Re-query CCDS DB by Protein ID:ENSMUSP00000101868
Original member Current member EBI,WTSI ENSMUST00000106262.1 ENSMUSP00000101869.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106262.1Link to Ensembl Protein Viewer:ENSMUSP00000101869.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000106262Re-query CCDS DB by Protein ID:ENSMUSP00000101869
Original member Current member EBI,WTSI ENSMUST00000106263.7 ENSMUSP00000101870.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106263.7Link to Ensembl Protein Viewer:ENSMUSP00000101870.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000106263Re-query CCDS DB by Protein ID:ENSMUSP00000101870
Original member Current member NCBI NM_001362189.1 NP_001349118.1 Accepted alive Link to Nucleotide Sequence:NM_001362189.1Link to Protein Sequence:NP_001349118.1Re-query CCDS DB by Nucleotide ID:NM_001362189Re-query CCDS DB by Protein ID:NP_001349118Link to BLAST:NP_001349118.1
Original member Current member NCBI NM_001362190.1 NP_001349119.1 Accepted alive Link to Nucleotide Sequence:NM_001362190.1Link to Protein Sequence:NP_001349119.1Re-query CCDS DB by Nucleotide ID:NM_001362190Re-query CCDS DB by Protein ID:NP_001349119Link to BLAST:NP_001349119.1
Original member Current member NCBI NM_001362191.1 NP_001349120.1 Accepted alive Link to Nucleotide Sequence:NM_001362191.1Link to Protein Sequence:NP_001349120.1Re-query CCDS DB by Nucleotide ID:NM_001362191Re-query CCDS DB by Protein ID:NP_001349120Link to BLAST:NP_001349120.1
Original member Current member NCBI NM_001362192.1 NP_001349121.1 Accepted alive Link to Nucleotide Sequence:NM_001362192.1Link to Protein Sequence:NP_001349121.1Re-query CCDS DB by Nucleotide ID:NM_001362192Re-query CCDS DB by Protein ID:NP_001349121Link to BLAST:NP_001349121.1
Original member Current member NCBI NM_146259.4 NP_666371.1 Accepted alive Link to Nucleotide Sequence:NM_146259.4Link to Protein Sequence:NP_666371.1Re-query CCDS DB by Nucleotide ID:NM_146259Re-query CCDS DB by Protein ID:NP_666371Link to BLAST:NP_666371.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001349118.1 619 Q8K2R5 619 100% 0 0
NP_001349119.1 619 Q8K2R5 619 100% 0 0
NP_001349120.1 619 Q8K2R5 619 100% 0 0
NP_001349121.1 619 Q8K2R5 619 100% 0 0
NP_666371.1 619 Q8K2R5 619 100% 0 0

Chromosomal Locations for CCDS 21881.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 127866151 127867363 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 127867756 127868402 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1860 nt):
ATGGAAGTGGAGGCTACAGAGGCCAGGTCCCCAGGCCCCTGCTACAAGCGCTCTGGCCGCCGTTATAAGT
GC
CTGTTTTGTACAAAGACATTTCCAAATGCACCCAGGGCAGCCCGCCATGCTGCTACACATACACCCAC
A
GACTGCACAGAGGAGGTGAGGGAGGCCCAGCCAAAAGTGGATACAGAGCCCAAGGCGGAGGAAGCCAGC
GGA
GACAAGGTATCAGCTTCAGTAGCCAAGCCCCGGCCCTATGCCTGCCCACTGTGCCCCAAGGCCTACA
AG
ACAGCTCCTGAGCTACGCAGCCATGGGCGCAGCCACACTGGTGAGAAACCCTTCCCGTGCCCAGAGTG
T
GGCCGCCGCTTCATGCAGCCAGTGTGCCTGCGTGTGCACCTGGCCTCACATGCCGGTGAGCTGCCCTTC
CGA
TGCACACACTGCCCCAAGGCTTATGGTACACTCTCTAAACTAAAGATCCACCAGCGTGGGCACACAG
GT
GAGCGGCCCTATGCCTGTCCTGACTGCGGCAAGAGCTTTGCTGATCCTTCAGTGTTCCGCAAGCATCG
G
CGCACCCATGCCGGCCTTCGACCCTACAGCTGCGAGCGCTGCGGCAAGGCCTATGCTGAGCTCAAGGAC
TTA
CGCAACCATGAAAGGTCCCACACGGGTGAGCGCCCCTTCCTCTGCTCGGAGTGTGGTAAAAGCTTCT
CT
CGATCCTCTTCCCTCACATGCCACCAGCGTATCCATGCAGCCCAGAAACCCTATCGCTGCCCGGCTTG
T
GGGAAGGGCTTCACACAGCTCAGCTCTTACCAAAGCCATGAGCGCACACATTCAGGCGAGAAGCCCTTC
CTG
TGCCCACGGTGTGGCCGCATGTTTTCTGATCCGTCAAGCTTCCGCCGTCACCAGCGCGCACATGAGG
GC
GTAAAGCCTTACCGCTGCGAGAAATGTGGCAAGGACTTCCGGCAGCCCGCCGACCTGGCCATGCATCG
G
CGAGTACACACCGGCGACCGACCCTTCAAGTGCCTGCAGTGTGACAAGACTTTTGTGGCTTCCTGGGAC
CTC
AAGCGGCATGCGTTGGTGCACTCAGGACAGCGGCCATTCCGCTGTGAGGAGTGTGGGCGAGCATTTG
CT
GAGCGAGCTAGCCTCACGAAGCACAGCCGCATGCACTCTGGGGAGCGTCCTTTCCACTGTAATGCCTG
T
GGGAAATCCTTTGTGGTGTTATCCAGCCTCAGGAAGCATGAGCGTACCCACAGAAGCAACGAGACTACA
GGA
GCTGCCCCCCAGCAGGAGTTGGTGCTGGGACTGGCACTGCCTGTAGGTGTCGTAGGTGAGGGCTCGG
CC
GCCCCCGTGGCGGGTGCAGGGGTAGGGGATGCTCCAGCGGGGCTGTTAGGGTTACCCCCTGAGTCTGG
T
GGTGTAGTGGCCACACAGTGGCAAGTGGTGGGTATGACTGTGGAACATGTGGAGTGCCAGGATGCTGGC
GTT
GGGGAAGCGCCTAGTACCCTGGGAGATGCAGGAGAGGTGGGGGGTGAGGAGACTGATGAGAAGCCCC
CA
CAGTTTGTGTGTCGCGAGTGCAAAGAAACTTTCTCCACACTGACACTGCTACGCAGGCACGAGCGCTC
A
CACCCGGAGCTCCGGCCCTTTCCCTGCACTCAGTGTGGTAAGAGCTTCTCAGACAGGGCTGGGCTTCGA
AAG
CATAGCCGCACCCACAGCTCTGTCCGCCCCTACTCCTGTTCCCAATGTCCTAAAGCTTTCCTGAGTG
CC
AGTGACCTGCGCAAGCATGAACGCACCCACCCCGTGCCCATCGGGACCCCCATACCCCTGGAACCTCT
T
GTGGCTTTGCTAGGAATGCCAGAAGAAGGGTCAGCTTGA


Translation (619 aa):
MEVEATEARSPGPCYKRSGRRYKCLFCTKTFPNAPRAARHAATHTPTDCTEEVREAQPKVDTEPKAEEAS
G
DKVSASVAKPRPYACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRRFMQPVCLRVHLASHAGELPF
R
CTHCPKAYGTLSKLKIHQRGHTGERPYACPDCGKSFADPSVFRKHRRTHAGLRPYSCERCGKAYAELKD
L
RNHE
RSHTGERPFLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGKGFTQLSSYQSHERTHSGEKPF
L
CPRCGRMFSDPSSFRRHQRAHEGVKPYRCEKCGKDFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWD
L
KRHALVHSGQRPFRCEECGRAFAERASLTKHSRMHSGERPFHCNACGKSFVVLSSLRKHERTHRSNETT
G
AAPQQELVLGLALPVGVVGEGSAAPVAGAGVGDAPAGLLGLPPESGGVVATQWQVVGMTVEHVECQDAG
V
GEAPSTLGDAGEVGGEETDEKPPQFVCRECKETFSTLTLLRRHERSHPELRPFPCTQCGKSFSDRAGLR
K
HSRTHSSVRPYSCSQCPKAFLSASDLRKHERTHPVPIGTPIPLEPLVALLGMPEEGSA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser