NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21772.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21772.1 Public Mus musculus 7 Tmc7 21 106 86 CCDS HistoryNCBI Gene:209760Re-query CCDS DB by CCDS ID:21772.1Re-query CCDS DB by GeneID:209760See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 21772.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000044195 ENSMUSP00000046927 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000044195Link to Ensembl Protein Viewer:ENSMUSP00000046927Re-query CCDS DB by Nucleotide ID:ENSMUST00000044195Re-query CCDS DB by Protein ID:ENSMUSP00000046927
Original member Current member EBI,WTSI OTTMUST00000077512 OTTMUSP00000041014 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000077512Link to Vega Protein Viewer:OTTMUSP00000041014Re-query CCDS DB by Nucleotide ID:OTTMUST00000077512Re-query CCDS DB by Protein ID:OTTMUSP00000041014
Original member Current member NCBI NM_172476.4 NP_766064.2 Accepted alive Link to Nucleotide Sequence:NM_172476.4Link to Protein Sequence:NP_766064.2Re-query CCDS DB by Nucleotide ID:NM_172476Re-query CCDS DB by Protein ID:NP_766064Link to BLAST:NP_766064.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_766064.2 726 Q8C428-1 726 100% 0 0

Chromosomal Locations for CCDS 21772.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 118538137 118538217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118539415 118539493 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118541886 118542041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118543299 118543429 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118545602 118545788 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118547317 118547414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118547604 118547721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118549935 118550092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118551136 118551309 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118552698 118552845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118555823 118555968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118558856 118558938 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118560991 118561158 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118564217 118564365 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118566185 118566425 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 118584604 118584667 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2181 nt):
ATGAGCGAGGGCAGCGCGGGCGACCCGGGCCACGGGTCCAGCCGGCAGCGGGCCGTACACCCAGAGAACC
TG
TCTCTGGGTTCTAGCTGTTTCTCTCCACCTGTGAACTTCCTTCAAGAGCTGCCAAGCTATCGGTCAGT
G
GCACGTAGGAGAACAAACATCCTCTCTCGGGACAAGCAAAGTGGCACCCTGCTGAAGCCGACAGACTCT
TTC
AGTTGCCAGCTGGATGGAGGAATCACAGAAAACCTCAACAGCCAATCCATCCGCAAGTATGCACTGA
AC
ATCTCTGAGAAGCGGAGACTAAGGGACATTCAGGAAACCCAAATGAAGTATTTATCAGAGTGGGACCA
G
TGGAAACGGTACAGCAGCAAGTCCTGGAAGAGGTTCCTAGAGAAAGCTCGAGAGATGACAACCCACCTG
GAA
CTGTGGCGCAAAGACATCCGCAGCATTGAAGGAAAGTTTGGCACGGGGATCCAGTCCTACTTCTCAT
TC
CTGCGGTTCCTGGTGGTGCTGAACCTGGTGATATTCCTGATCATCTTCATGTTGGTTTTGCTTCCAAT
C
CTACTCACCAAGTACAAGATTACCAACAGCACTTTTGTGCTCATCCCGTTCAAAGACATGGATATTCAG
TGC
ACACTGTATCCAATAAGTAGCTCTGGGCTCATTTACTTCTACAGTTACATCATAGACCTGCTGTCTG
GA
ACAGGATTCTTGGAGGAGACCAGCCTTTTTTATGGGCACTACACCATTGATGGTGTAAAGTTCCAGAG
C
TTCACGTATGACCTGCCCCTGGCTTACTTGATAAGCACGATTGCCTACCTGGCCCTGAGCCTCCTTTGG
ATC
GTGAAAAGGTCGGTGGAAGGGTTCAAGATCAACCTGATTCGGAGCGAGGAACACTTTCAGAGTTACT
GT
AATAAGATCTTCGCTGGCTGGGACTTCTGCATCACCAACCGCAGCATGGCTGAGCTGAAGCACAGCAG
C
TTGCGGTACGAGCTCCGAGCAGATCTGGAAGAAGAGAGAATACGACAGAAAATAGCAGAAAGGACCTCA
GAG
GAGACCATCCGCATTTACACTTTGAGGCTGTTTTTGAACTGCATTGTGCTTGCTGTGCTAGCGGCAT
GC
TTTTATGCAATCTACCTAGCAACTGCCTTCTCACAGGAACACATGAAAAAAGAAATTGACAAGATGGT
T
TTTGGGGAGAACCTGTTGATATTGTACCTCCCGTCCATTGTGATTACCCTGGCCAATTTCATTACCCCA
ATC
ATCTTTGCCAAGATCATCCACTACGAGGATTACTCGCCAGGCTTTGAGATCCGCCTGACGATTCTTA
G
G
TGTGTCTTTATGCGGCTGGCCACCATCTGTGTGCTGGTGTTCACGCTGGGCTCCAAGATCACATCCTG
T
GGTGACAGCACGTGTGAACTCTGCGGCTATAACCAGAAACTCTACCCGTGCTGGGAGACTCAGGTGGGA
CAG
GAAATGTACAAGCTGATGATCTTCGACTTCATCATCATCCTGGCCGTGACGCTGTTTGTGGATTTCC
CT
AGGAAGCTCCTGGTGACCTACTGTGCCTCCTCAAAGCTGATCCAGTGCTGGGGCCAGCAGGAATTCGC
C
ATCCCCGACAATGTCCTGGGCATCGTGTACGGGCAGACCATCTGTTGGATTGGAGCCTTCTTCTCCCCA
CTC
CTCCCTGCCATTGCCACCTTGAAATTCGTTATCATCTTTTATGTGAAAGAGTTGAGTCTTCTCTACA
CC
TGCAGACCCTCCCCGAGGCAGTTCAGAGCATCCAATTCTAACTTCTTCTTCCTGCTGGTGTTGCTGAT
T
GGGCTGTGCCTAGCAATCATACCTCTGACCATCAGCATGGCTCGCATCCCTTCCTCAAAAGCCTGCGGC
CCA
TTTACCAACTTCAACACCACCTGGGAAGTGATTCCTCAGACTGTGAGCACCTTCCCCAGCTCGCTGC
AG
ACCCTGATCCATGCCGTTACATCAGAAGCCTTCGCGGTGCCTTTCTTCATGATCATCTGCCTTGTCAT
G
TTCTACTTCATTGCACTGGCTGGAGCACACAAGCAGGTGGTTGTACAGCTTCGAGAGCAGCTGTCCCTG
GAG
AGTCGTGACAAGCGTTATCTTATCCAGAAACTAACAGAAGCTCAAAGGGAGGTCCGGAGCCAGCCGG
CT
TCAGCATGA


Translation (726 aa):
MSEGSAGDPGHGSSRQRAVHPENLSLGSSCFSPPVNFLQELPSYRSVARRRTNILSRDKQSGTLLKPTDS
F
SCQLDGGITENLNSQSIRKYALNISEKRRL
RDIQETQMKYLSEWDQWKRYSSKSWKRFLEKAREMTTHL
E
LWRKDIRSIE
GKFGTGIQSYFSFLRFLVVLNLVIFLIIFMLVLLPILLTKYKITNSTFVLIPFKDMDIQ
C
TLYPISSSGLIYFYSYIIDLLSGT
GFLEETSLFYGHYTIDGVKFQSFTYDLPLAYLISTIAYLALSLLW
I
VK
RSVEGFKINLIRSEEHFQSYCNKIFAGWDFCITNRSMAELKHSSLRYELRADLEEERIRQKIAERTS
E
ETIRIYTLRLFLNCIVLAVLAACFYAIYLATAFSQEHMKK
EIDKMVFGENLLILYLPSIVITLANFITP
I
IFAKIIHYEDYSPGFEIRLTIL
RCVFMRLATICVLVFTLGSKITSCGDSTCELCGYNQKLYPCWETQVG
Q
EMYKLMIFDFIIILAVTLFVDFPR
KLLVTYCASSKLIQCWGQQEFAIPDNVLGIVYGQTICWIGAFFSP
L
LPAIATLKFVIIFYVKE
LSLLYTCRPSPRQFRASNSNFFFLLVLLIGLCLAIIPLTISMARIPSSKACG
P
FTNFNTTWEVIPQTVSTFPSSLQTLIHAVTSEAFAVPFFMII
CLVMFYFIALAGAHKQVVVQLREQLSL
E
SRDKRYLIQKLTEAQREVRSQPASA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser