NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21771.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21771.1 Public Mus musculus 7 Coq7 23 108 98 CCDS HistoryNCBI Gene:12850Re-query CCDS DB by CCDS ID:21771.1Re-query CCDS DB by GeneID:12850See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21771.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000032887.3 ENSMUSP00000032887.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000032887.3Link to Ensembl Protein Viewer:ENSMUSP00000032887.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000032887Re-query CCDS DB by Protein ID:ENSMUSP00000032887
Original member Current member NCBI NM_009940.3 NP_034070.1 Accepted alive Link to Nucleotide Sequence:NM_009940.3Link to Protein Sequence:NP_034070.1Re-query CCDS DB by Nucleotide ID:NM_009940Re-query CCDS DB by Protein ID:NP_034070Link to BLAST:NP_034070.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034070.1 217 P97478 217 100% 0 0

Chromosomal Locations for CCDS 21771.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 118525217 118525294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 118525824 118525892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 118527337 118527476 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 118528304 118528418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 118529559 118529737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 118533179 118533251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (654 nt):
ATGAGCGCCGCCGGAGCCATAGCGGCTGCTTCCGTGGGACGCCTGCGCACTGGTGTCCGGAGGCCCTTCT
CA
GAGTATGGAAGAGGCCTCATCATCAGGTGTCACAGTTCGGGGATGACCTTAGACAATATTAACCGGGC
A
GCCGTGGATCGAATAATTCGGGTGGATCACGCTGGTGAATATGGAGCAAACCGCATCTATGCAGGGCAA
ATG
GCCGTGCTCGGTCGGACCAGTGTTGGCCCTGTCATTCAGAAAATGTGGGATCAAGAGAAGAACCATT
TG
AAAAAGTTCAACGAGTTGATGATTGCATTCAGGGTCCGACCTACGGTTTTGATGCCCTTGTGGAACGT
G
GCAGGCTTTGCCCTGGGGGCAGGAACTGCCTTGCTGGGGAAGGAAGGAGCAATGGCCTGCACCGTGGCG
GTA
GAAGAGTCTATCGCTAATCACTACAACAACCAGATCCGCATGCTGATGGAAGAGGACCCTGAGAAGT
AT
GAGGAGCTGCTGCAGGTCATCAAGCAGTTTCGCGATGAGGAGCTTGAACACCACGATACAGGCCTGGA
C
CATGACGCAGAGCTGGCTCCCGCGTATGCCTTGTTGAAGAGGATTATCCAGGCCGGATGCAGTGCAGCC
ATA
TATTTATCAGAAAGGTTTTAG


Translation (217 aa):
MSAAGAIAAASVGRLRTGVRRPFSEYGRGLIIRCHSSGMTLDNINRAAVDRIIRVDHAGEYGANRIYAGQ
M
AVLGRTSVGPVIQ
KMWDQEKNHLKKFNELMIAFRVRPTVLMPLWNVAGFALGAGTALLGKEGAMACTVA
V
EESIANHYNNQIRMLMEEDPEKYEELLQ
VIKQFRDEELEHHDTGLDHDAELAPAYALLKRIIQAGCSAA
I
YLSERF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser