NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21522.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21522.1 Public Mus musculus 7 Il18bp 21 106 86 CCDS HistoryNCBI Gene:16068Re-query CCDS DB by CCDS ID:21522.1Re-query CCDS DB by GeneID:16068See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21522.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000094134 ENSMUSP00000091685 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000094134Link to Ensembl Protein Viewer:ENSMUSP00000091685Re-query CCDS DB by Nucleotide ID:ENSMUST00000094134Re-query CCDS DB by Protein ID:ENSMUSP00000091685
Original member Current member EBI,WTSI ENSMUST00000209844 ENSMUSP00000148080 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000209844Link to Ensembl Protein Viewer:ENSMUSP00000148080Re-query CCDS DB by Nucleotide ID:ENSMUST00000209844Re-query CCDS DB by Protein ID:ENSMUSP00000148080
Original member Current member EBI,WTSI OTTMUST00000149383 OTTMUSP00000077520 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000149383Link to Vega Protein Viewer:OTTMUSP00000077520Re-query CCDS DB by Nucleotide ID:OTTMUST00000149383Re-query CCDS DB by Protein ID:OTTMUSP00000077520
Original member Current member EBI,WTSI OTTMUST00000149384 OTTMUSP00000077521 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000149384Link to Vega Protein Viewer:OTTMUSP00000077521Re-query CCDS DB by Nucleotide ID:OTTMUST00000149384Re-query CCDS DB by Protein ID:OTTMUSP00000077521
Original member NCBI NM_010531.1 NP_034661.1 Updated not alive Link to Nucleotide Sequence:NM_010531.1Link to Protein Sequence:NP_034661.1Re-query CCDS DB by Nucleotide ID:NM_010531Re-query CCDS DB by Protein ID:NP_034661
Current member NCBI NM_010531.2 NP_034661.1 Accepted alive Link to Nucleotide Sequence:NM_010531.2Link to Protein Sequence:NP_034661.1Re-query CCDS DB by Nucleotide ID:NM_010531Re-query CCDS DB by Protein ID:NP_034661Link to BLAST:NP_034661.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034661.1 193 Q9Z0M9 193 100% 0 0

Chromosomal Locations for CCDS 21522.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 102015746 102015835 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102016043 102016190 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102016278 102016401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102016750 102016941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102017287 102017314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (582 nt):
ATGACCATGAGACACTGCTGGACAGCAGGCCCCAGTTCTTGGTGGGTCCTGCTTTTGTATGTCCATGTCA
TT
TTGGCCAGAGCCACATCTGCACCTCAGACAACTGCCACTGTCTTAACTGGAAGCTCAAAAGACCCATG
C
TCTTCCTGGTCTCCAGCAGTCCCAACTAAGCAGTACCCAGCACTGGATGTGATTTGGCCAGAAAAAGAA
GTG
CCACTGAATGGAACTCTGACCTTGTCCTGTACTGCCTGCAGCCGCTTCCCCTACTTCAGCATCCTCT
AC
TGGCTGGGCAATGGTTCCTTCATTGAGCACCTCCCAGGCCGGCTGAAGGAGGGCCACACAAGTCGCGA
G
CACAGGAACACAAGCACCTGGCTGCACAGGGCCTTGGTGCTGGAAGAACTGAGCCCCACCCTACGAAGT
ACC
AACTTCTCCTGTTTGTTTGTGGATCCTGGACAAGTGGCCCAGTATCACATCATTCTGGCCCAGCTCT
GG
GATGGGTTGAAGACAGCTCCGTCCCCTTCTCAAGAAACCCTCTCTAGCCACAGCCCAGTATCCAGATC
A
GCAGGCCCAGGGGTTGCATAA


Translation (193 aa):
MTMRHCWTAGPSSWWVLLLYVHVILARATSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKE
V
PL
NGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRS
T
NFSCLFVDPGQVAQYHIILAQLW
DGLKTAPSPSQETLSSHSPVSRSAGPGVA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser