NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21476.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21476.1 Public Mus musculus 7 Uvrag 23 108 98 CCDS HistoryNCBI Gene:78610Re-query CCDS DB by CCDS ID:21476.1Re-query CCDS DB by GeneID:78610See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21476.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000037968.9 ENSMUSP00000045297.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000037968.9Link to Ensembl Protein Viewer:ENSMUSP00000045297.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000037968Re-query CCDS DB by Protein ID:ENSMUSP00000045297
Original member Current member NCBI NM_178635.3 NP_848750.3 Accepted alive Link to Nucleotide Sequence:NM_178635.3Link to Protein Sequence:NP_848750.3Re-query CCDS DB by Nucleotide ID:NM_178635Re-query CCDS DB by Protein ID:NP_848750Link to BLAST:NP_848750.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_848750.3 698 Q8K245 698 100% 0 0

Chromosomal Locations for CCDS 21476.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 98887890 98888592 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 98906492 98906583 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 98939891 98939969 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 98979636 98979801 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 98988184 98988244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 98989535 98989622 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 98991924 98992008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99004580 99004706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99016569 99016674 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99065800 99065882 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99088101 99088175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99099312 99099473 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99109063 99109097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99118188 99118305 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99140834 99140950 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2097 nt):
ATGAGCTCCTGCGCCTCGCTCGGGGGCCCGGTGCCCCTGCCACCCCCGGGCCCGTCCGCCGCGCTGACGT
CC
GGTGCCCCCGCGCGGGCCCTGCATGTGGAGCTGCCGTCTCAGCAGCGGCGTCTCCGACATCTCCGGAA
C
ATCGCTGCTCGGAACATTGTTAATAGAAATGGCCATCAGCTTCTGGATACCTACTTCACTCTTCATTTG
TGT
GATAATGAGAAAATCTTTAAAGAATTTTATAGGAGTGAAGTGATTAAGAATTCCTTGAATCCGACGT
GG
AGGAGTCTTGACTTTGGAATAATGCCGGATCGTCTGGATACATCTGTGTCCTGCTTTGTGGTGAAGAT
T
TGGGGTGGAAAGGAAGAGGCCTTTCAGCTGTTGATAGAGTGGAAAGTCTACCTGGATGGGCTGAAGTAC
TTG
GGACAGCAGATCCATGCCCGCAACCAGAATGAAATCATTTTTGGGCTGAATGATGGCTACTACGGTG
CT
CCCTGTGAACACAAGGGTCATCCAAACGCACAGAAGAACCTCCTTCAGGTGGACCAGAACTGTGTTCG
C
AATTCTTACGATGTCTTCTCTTTGCTGCGGCTTCATAGAGCCCAGTGTGCAATTAAACAGACTCAGGTA
ACT
GTTCAGAGACTTGGAAAGGAAATTGAAGAAAAACTAAGACTCACATCGACAAGCAATGAGCTGAAAA
AA
GAAAGTGAATGTCTGCGATTGAAAATTTTGGTGCTTCGAAATGAACTGGAAAGACAGAAGAAAGCGCT
G
GGGCGGGAGGTGGCCTTCCTGCATAAGCAACAGATGGCTCTACAGGACAAAGGAAGTGCATTTTCCACT
GAG
CATGGCAAGCTCCAGCTGCAGAAGGACTCCCTGAGTGAGCTGAGGAAGGAGTGTACTGCCAAAAGGG
AA
CTCTTTCTGAAGACTAATGCTCAGTTGACCATCCGCTGCAGGCAGCTACTCTCAGAGCTGTCCTACAT
T
TACCCTATTGATTTGAATGAGAACAAGGATTATTTTGTATGTGGTGTCAAGTTGCCTAATTCCGAGGAC
TTC
CAAGCAAAAGATGATGGAAGCATTGCCGTCGCCCTTGGTTACACTGCACATTTGGTCTCCATGATCT
CC
TTCTTCCTACAAGTACCCCTCAGGTATCCCATAATTCACAAGGGGTCCAGATCAACAATCAAAGATAA
C
ATCAACGACAAGCTGACAGAAAAGGAGCGAGAGTTTCCACTGTATCCAAAGGGAGGGGAGAAGCTGCAG
TTT
GACTATGGTGTCTACCTTCTGAACAAGAACATAGCACAGCTGAGATACCAGCATGGCCTGGGGACTC
CA
GACTTGAGGCAAACTCTTCCTAACCTGAAAAACTTCATGGAGCACGGACTGATGGTCAGGTGTGACAG
A
CATCACATCTCCAATGCCATCCCTGTCCCGAAGAGACAAAGCTCCACGTTTGGGGGTGCAGATGGAGGC
TTC
TCTGCGGGTATCCCATCACCAGATAAAGTCCATCGCAAGCGGGCCAGCTCAGAGAACGAGAGACTCC
AG
TACAAAACCCCACCTCCCAGCTACAATTCAGCATTGACACAGCCCGGGGTGGCCATGCCCACCTCGGG
A
GACTCTGAGAGAAAGGTCGCCCCTCTGTCCTCCTCCCTGGACACCTCCCTGGACTTCTCCAAAGAAAAC
AAG
AAAGCAGGAGTAGACCTGGGCAGCAGTGTGAGCGGAGACCACGGAAACTCGGACTCCGGCCAAGAGC
AG
GGGGAAGCCCTGCCTGGGCACCTGGCAGCCGTGAATGGCACTGCACTGCCCAGCGAGCAGGCTGGCCC
T
GCCGGCACCCTGCTGCCAGGCTCGTGCCACCCGGCCCCCTCAGCTGAGCTCTGCTGTGCAGTGGAGCAA
GCA
GAGGAAATCATCGGGCTGGAAGCCACAGGCTTCACCTCGGGTGACCAGCTGGAGGCGCTCAGCTGCA
TC
CCGGTGGACAGCGCAGTGGCAGTGGAGTGTGACGAGCAGGTGCTGGGGGAGTTTGAGGAGTTCTCTCG
C
AGGATCTATGCCCTCAGCGAGAACGTGTCCAGCTTCCGCCGGCCTCGCAGGAGTTCCGACAAGTGA


Translation (698 aa):
MSSCASLGGPVPLPPPGPSAALTSGAPARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHL
C
DNEKIFK
EFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKEEAFQLLIEWKVYLDGLKY
L
GQQ
IHARNQNEIIFGLNDGYYGAPCEHKGHPNAQKNLLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQV
T
VQRLGKEIEEKLRLTSTSNEL
KKESECLRLKILVLRNELERQKKALGREVAFLHKQQMALQDKGSAFST
E
HGKLQLQKDSLSELRKECTAK
RELFLKTNAQLTIRCRQLLSELSYIYPIDLNENKDYFVCGVKLPNSED
F
Q
AKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQ
F
DYGVYLLNKNIAQ
LRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHISNAIPVPKRQSSTFGGADGG
F
SAGIPSPDKVHRKRASSENERLQYKTPPPSYNSALTQPGVAMPTSGDSERKVAPLSSSLDTSLDFSKEN
K
KAGVDLGSSVSGDHGNSDSGQEQGEALPGHLAAVNGTALPSEQAGPAGTLLPGSCHPAPSAELCCAVEQ
A
EEIIGLEATGFTSGDQLEALSCIPVDSAVAVECDEQVLGEFEEFSRRIYALSENVSSFRRPRRSSDK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser