NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21307.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21307.1 Public Mus musculus 7 Prmt3 21 106 86 CCDS HistoryNCBI Gene:71974Re-query CCDS DB by CCDS ID:21307.1Re-query CCDS DB by GeneID:71974See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21307.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000032715 ENSMUSP00000032715 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000032715Link to Ensembl Protein Viewer:ENSMUSP00000032715Re-query CCDS DB by Nucleotide ID:ENSMUST00000032715Re-query CCDS DB by Protein ID:ENSMUSP00000032715
Original member Current member EBI,WTSI OTTMUST00000048733 OTTMUSP00000022425 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000048733Link to Vega Protein Viewer:OTTMUSP00000022425Re-query CCDS DB by Nucleotide ID:OTTMUST00000048733Re-query CCDS DB by Protein ID:OTTMUSP00000022425
Original member Current member NCBI NM_133740.2 NP_598501.1 Accepted alive Link to Nucleotide Sequence:NM_133740.2Link to Protein Sequence:NP_598501.1Re-query CCDS DB by Nucleotide ID:NM_133740Re-query CCDS DB by Protein ID:NP_598501Link to BLAST:NP_598501.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_598501.1 528 Q922H1-2 528 100% 0 0

Chromosomal Locations for CCDS 21307.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 49778477 49778501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49778581 49778713 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49780309 49780391 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49781121 49781170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49781942 49782044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49786067 49786226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49787233 49787374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49791973 49792038 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49798306 49798427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49806527 49806626 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49818032 49818110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49826708 49826895 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49828944 49829030 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49848495 49848545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49848737 49848824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 49857367 49857476 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1587 nt):
ATGTGTTCGCTAGCGGCGGGGAACGGCCGTGGCGCCGAGCTGGGGCCGGAGCCCCTGGAACTGTCGGACA
GC
GGAGACGACGCGGGCTGGGAGGACGAGGACGCGGACACTGAGCCCGCGCACGGCCGGCAGCACACACC
C
TGCCTGTTCTGTGACAGGTTGTTCGCCTCTGCTGAGGAAACGTTTTCACACTGTAAGTTGGAGCATCAA
TTT
AATATTGATAGTATGGTCCATAAACATGGACTTGAATTTTATGGATACATTAAACTAATAAATTTTA
TT
AGACTTAAGAATCCTACGGTTGAATATATGAATTCCATATATAACCCTGTGCCTTGGGAAAAAGATGA
G
TACCTGAAGCCAGTGTTGGAAGATGACCTTTTGCTTCAGTTTGATGTAGAAGATCTTTATGAGCCTGTG
TCT
ACTCCATTCTCATACCCCAATGGACTCAGTGAAAGCGCATCTGTTGTTGAGAAGTTGAAGCACATGG
AA
GCGCGGGCGCTGTCTGCTGAGGCTGCCTTGGCTCGGGCGCGTGAGGATCTGCAGAAGATGAAACAATT
T
GCTCAGGACTTTGTGATGAACGTAGATGTCAGAACCTGCTCCTCCACGACGACCATTGCAGACCTGCAG
GAG
GATGAGGATGGCGTCTACTTCAGCTCCTATGGGCATTATGGGATACATGAAGAAATGCTAAAGGACA
AA
GTACGCACAGAAAGTTACAGAGATTTCATATACCAAAATCCACACATCTTCAAAGATAAGGTTGTTCT
G
GATGTTGGGTGTGGAACTGGAATTCTCTCCATGTTTGCTGCCAAAGTTGGGGCAAAGAAAGTGATTGCA
GTC
GACCAGTCTGAAATCCTCTACCAGGCTATGGATATCATAAGACTAAATAAACTTGAAGATACCATTG
TA
CTAATTAAAGGAAAGATTGAAGAAGTGAGTCTTCCTGTGGAAAAGGTGGATGTTATTATATCAGAGTG
G
ATGGGCTATTTTCTTCTTTTTGAGTCGATGTTGGATTCTGTCCTTTATGCTAAGAGTAAATACTTGGCA
AAA
GGGGGATCGGTCTACCCTGACATTTGCACCATCAGCCTTGTAGCTGTGAGTGATGTGAGCAAGCACG
CC
GATAGAATTGCCTTCTGGGATGACGTCTATGGCTTCAACATGTCCTGCATGAAGAAAGCAGTTATACC
G
GAAGCTGTTGTGGAAGTTGTGGATCACAAGACTCTTATTTCAGACCCTTGTGATATCAAGCACATAGAC
TGC
CACACCACGTCTATCTCAGACTTGGAGTTTTCTTCAGATTTTACCCTGAGAACCACAAAGACGGCCA
TG
TGCACGGCAGTTGCTGGGTACTTTGATATATATTTTGAGAAGAATTGCCACAACAGGGTCGTGTTCTC
T
ACTGGCCCCCAGAGCACCAAAACACACTGGAAACAGACAGTATTTCTGCTGGAAAAACCTTTTCCGGTT
AAA
GCAGGTGAAGCTCTGAAAGGAAAGATCACAGTTCACAAGAATAAGAAGGATCCTCGTTCCCTCATTG
TG
ACCCTGACTTTGAACAGTTCAACCCAGACTTACAGTCTCCAGTGA


Translation (528 aa):
MCSLAAGNGRGAELGPEPLELSDSGDDAGWEDEDADTEPAHGRQHTPCLFCDRLFASAEETFSHCKLEHQ
F
NIDSMVHKH
GLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKDEYLKPVLEDDLLLQFDVEDLYEPV
S
TPFSYPNGLSESASVVEKLKHMEARALSAEAALARAREDLQKM
KQFAQDFVMNVDVRTCSSTTTIADLQ
E
DEDGVYFSSYGHYGIHEEMLK
DKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKVGAKKVIA
V
DQSEILYQAMDII
RLNKLEDTIVLIKGKIEEVSLPVEKVDVIISEWMGYFLLFESMLDSVLYAKSKYLA
K
GGS
VYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIKHID
C
HTTSISDLEFSSDFTLRTTKTAMCT
AVAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFPV
K
A
GEALKGKITVHKNKKDPRSLIVTLTLNSSTQTYSLQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser