NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21222.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21222.1 Public Mus musculus 7 Prmt1 21 106 86 CCDS HistoryNCBI Gene:15469Re-query CCDS DB by CCDS ID:21222.1Re-query CCDS DB by GeneID:15469See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21222.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000107843 ENSMUSP00000103474 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107843Link to Ensembl Protein Viewer:ENSMUSP00000103474Re-query CCDS DB by Nucleotide ID:ENSMUST00000107843Re-query CCDS DB by Protein ID:ENSMUSP00000103474
Original member Current member EBI,WTSI OTTMUST00000048689 OTTMUSP00000022387 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000048689Link to Vega Protein Viewer:OTTMUSP00000022387Re-query CCDS DB by Nucleotide ID:OTTMUST00000048689Re-query CCDS DB by Protein ID:OTTMUSP00000022387
Original member Current member NCBI NM_019830.3 NP_062804.1 Accepted alive Link to Nucleotide Sequence:NM_019830.3Link to Protein Sequence:NP_062804.1Re-query CCDS DB by Nucleotide ID:NM_019830Re-query CCDS DB by Protein ID:NP_062804Link to BLAST:NP_062804.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062804.1 371 Q9JIF0-1 371 100% 0 0

Chromosomal Locations for CCDS 21222.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 44976900 44976983 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44977504 44977625 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44978127 44978277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44978675 44978790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44978883 44978970 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44979383 44979525 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44981587 44981650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44981738 44981893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44983486 44983587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44984080 44984133 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44986283 44986318 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1116 nt):
ATGGCGGCAGCCGAGGCCGCGAACTGCATCATGGAGAATTTTGTAGCCACCTTGGCTAATGGGATGAGCC
TC
CAGCCGCCTCTTGAAGAAGTTTCCTGTGGCCAAGCAGAAAGTAGTGAGAAGCCCAACGCTGAGGACAT
G
ACATCCAAAGACTACTACTTTGACTCCTATGCCCACTTTGGCATCCACGAGGAGATGCTGAAGGATGAG
GTG
CGCACCCTCACATACCGCAACTCCATGTTTCACAATCGGCATCTCTTCAAAGACAAGGTGGTGCTGG
AT
GTGGGCTCAGGCACTGGCATCCTCTGCATGTTTGCTGCCAAGGCGGGGGCCCGCAAGGTTATTGGGAT
T
GAGTGTTCCAGTATCTCCGATTATGCTGTGAAGATTGTCAAAGCCAACAAGTTAGACCATGTGGTGACC
ATC
ATCAAGGGCAAGGTGGAGGAGGTGGAGCTGCCCGTGGAGAAGGTGGACATCATCATCAGCGAGTGGA
TG
GGTTACTGCCTCTTCTACGAGTCCATGCTCAACACCGTGCTGCACGCTCGGGACAAGTGGCTGGCACC
C
GATGGCCTCATCTTCCCAGACCGGGCCACCTTGTATGTGACAGCCATTGAGGACCGACAATATAAAGAC
TAC
AAGATCCACTGGTGGGAGAACGTGTATGGCTTTGATATGTCCTGCATTAAAGACGTGGCCATCAAGG
AG
CCCCTGGTGGACGTGGTGGACCCAAAGCAGCTGGTCACCAATGCCTGCCTCATAAAGGAGGTGGACAT
C
TACACAGTCAAGGTGGAGGACCTGACCTTCACCTCCCCCTTCTGCCTGCAAGTGAAGAGGAACGACTAC
GTG
CACGCGCTGGTGGCTTACTTCAACATCGAGTTCACCCGATGCCACAAGAGGACCGGCTTCTCCACCA
GT
CCTGAGTCCCCGTACACACACTGGAAGCAGACTGTGTTCTACATGGAGGACTACCTAACAGTGAAGAC
T
GGCGAGGAGATCTTTGGCACCATTGGAATGAGGCCCAATGCCAAAAACAATCGTGACTTGGACTTTACC
ATC
GACCTGGACTTCAAGGGTCAGCTGTGTGAGCTCTCTTGTTCCACCGACTACCGGATGCGCTGA


Translation (371 aa):
MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDE
V
RTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIG
IECSSISDYAVKIVKANKLDHVVT
I
IKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWL
APDGLIFPDRATLYVTAIEDRQYKD
Y
KIH
WWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDY
V
HALVAYFNIEFTRCHKRTGFST
SPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFT
I
DLDFKGQLCELSCSTDYRMR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser