NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21198.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21198.1 Public Mus musculus 7 Klk1b24 21 106 86 CCDS HistoryNCBI Gene:16617Re-query CCDS DB by CCDS ID:21198.1Re-query CCDS DB by GeneID:16617See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21198.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000073713 ENSMUSP00000073392 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000073713Link to Ensembl Protein Viewer:ENSMUSP00000073392Re-query CCDS DB by Nucleotide ID:ENSMUST00000073713Re-query CCDS DB by Protein ID:ENSMUSP00000073392
Original member Current member EBI,WTSI OTTMUST00000067395 OTTMUSP00000033904 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000067395Link to Vega Protein Viewer:OTTMUSP00000033904Re-query CCDS DB by Nucleotide ID:OTTMUST00000067395Re-query CCDS DB by Protein ID:OTTMUSP00000033904
Original member Current member NCBI NM_010643.2 NP_034773.1 Accepted alive Link to Nucleotide Sequence:NM_010643.2Link to Protein Sequence:NP_034773.1Re-query CCDS DB by Nucleotide ID:NM_010643Re-query CCDS DB by Protein ID:NP_034773Link to BLink:NP_034773.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034773.1 263 Q61754 263 100% 0 0

Chromosomal Locations for CCDS 21198.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 44188273 44188318 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44190265 44190424 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44191356 44191648 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44191744 44191880 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 44192251 44192406 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (792 nt):
ATGTGGTTCCTGATCCTGTTCCTAGCCCTGTCCCTAGGAGGGATTGATGCTGCACCTCCTGTCCAGTCTC
GT
GTGGTTGGAGGATTCAAATGTGAGAAGAATTCCCAACCCTGGCATGTGGCTGTGTTCCGCTACAACAA
A
TATATATGCGGGGGAGTCCTGTTGAACCCCAACTGGGTTCTCACAGCTGCCCACTGCTATGGCAATGCC
ACC
AGCCAGTATAATGTTTGGCTGGGCAAAAACAAGCTATTCCAACGTGAACCCTCTGCTCAGCACCGAT
GG
GTCAGCAAAAGCTTCCCTCACCCTGACTACAACATGAGCCTCCTGAATGATGACATCCCGCAACCTAA
G
GACAAGAGCAATGACCTGATGCTGCTCCGTCTCAGCGAGCCTGCTGACATCACAGATGCTGTGAAGCCC
ATC
GACCTGCCCACTGAGGAGCCCAAGCTGGGGAGCACATGCCTAGCCTCAGGCTGGGGCAGCATTACAC
CC
ACGAAATGGCAAAAGCCAAATGACCTTCAGTGTGTGTTCATCAAGCTCCTGCCCAATGAGAACTGTAC
C
AAACCCTACTTACATAAAGTCACAGATGTCATGCTGTGTGCAGGAGAGATGGGTGGAGGCAAAGACACT
TGT
GCGGGTGACTCAGGAGGCCCACTGATCTGTGATGGTATTCTCCACGGTATCACATCATGGGGTCCTG
TC
CCATGTGGTAAACCCAATGCGCCGGCCATCTACACCAAACTTATTAAGTTTGCCTCCTGGATAAAAGA
C
ACTATGGCCAAAAACCCCTGA


Translation (263 aa):
MWFLILFLALSLGGIDAAPPVQSRVVGGFKCEKNSQPWHVAVFRYNKYICGGVLLNPNWVLTAAHCYGNA
T
SQYNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDDIPQPKDKSNDLMLLRLSEPADITDAVKP
I
DLPTEEPKLGSTCLASGWGSITPTK
WQKPNDLQCVFIKLLPNENCTKPYLHKVTDVMLCAGEMGGGKDT
C
A
GDSGGPLICDGILHGITSWGPVPCGKPNAPAIYTKLIKFASWIKDTMAKNP



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser