NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, June 18, 2019, starting at 8:15 a.m. EDT for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21183.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21183.1 Public Mus musculus 7 Klk7 21 106 86 CCDS HistoryNCBI Gene:23993Re-query CCDS DB by CCDS ID:21183.1Re-query CCDS DB by GeneID:23993See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21183.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000032955 ENSMUSP00000032955 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000032955Link to Ensembl Protein Viewer:ENSMUSP00000032955Re-query CCDS DB by Nucleotide ID:ENSMUST00000032955Re-query CCDS DB by Protein ID:ENSMUSP00000032955
Original member Current member EBI,WTSI OTTMUST00000143199 OTTMUSP00000074662 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000143199Link to Vega Protein Viewer:OTTMUSP00000074662Re-query CCDS DB by Nucleotide ID:OTTMUST00000143199Re-query CCDS DB by Protein ID:OTTMUSP00000074662
Original member Current member NCBI NM_011872.3 NP_036002.1 Accepted alive Link to Nucleotide Sequence:NM_011872.3Link to Protein Sequence:NP_036002.1Re-query CCDS DB by Nucleotide ID:NM_011872Re-query CCDS DB by Protein ID:NP_036002Link to BLAST:NP_036002.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_036002.1 249 Q91VE3 249 100% 0 0

Chromosomal Locations for CCDS 21183.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 43811961 43812027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 43812360 43812501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 43812795 43813042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 43813230 43813366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 43815297 43815452 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (750 nt):
ATGGGAGTCTGGCTCCTTTCCCTGATAACTGTGCTGCTGTCTTTAGCCCTGGAAACCGCTGGACAAGGAG
AA
AGGATTATAGATGGCTACAAATGTAAAGAAGGCTCGCACCCATGGCAGGTGGCTCTGCTCAAAGGCAA
T
CAGCTTCACTGTGGAGGGGTGCTGGTGGACAAATACTGGGTGCTCACAGCAGCCCACTGCAAAATGGGT
CAG
TACCAAGTACAGCTGGGCAGTGATAAAATAGGGGACCAGAGTGCCCAGAAGATCAAGGCTACAAAGT
CA
TTCCGGCACCCTGGCTACTCCACAAAGACCCACGTCAATGACATCATGCTTGTGAGGTTGGATGAGCC
A
GTCAAGATGTCATCCAAAGTGGAGGCAGTCCAGCTTCCTGAACACTGTGAACCCCCAGGGACGTCATGT
ACC
GTCTCTGGATGGGGCACCACAACCAGCCCAGACGTGACCTTTCCCTCGGATCTTATGTGCTCGGATG
TG
AAGCTCATCTCCTCCAGGGAGTGCAAGAAGGTGTACAAGGACCTGCTGGGGAAAACCATGCTGTGTGC
T
GGCATTCCTGACTCTAAGACCAACACGTGCAATGGTGACTCAGGGGGGCCCTTGGTGTGCAACGACACC
CTC
CAAGGTCTGGTGTCCTGGGGTACCTACCCTTGTGGCCAGCCCAACGACCCAGGCGTCTACACTCAAG
TC
TGCAAGTACAAACGGTGGGTGATGGAGACCATGAAAACCCATCGCTAA


Translation (249 aa):
MGVWLLSLITVLLSLALETAGQGERIIDGYKCKEGSHPWQVALLKGNQLHCGGVLVDKYWVLTAAHCKMG
Q
YQVQLGSDKIGDQSAQKIKATKSFRHPGYSTKTHVNDIMLVRLDEPVKMSSKVEAVQLPEHCEPPGTSC
T
VSGWGTTTSPD
VTFPSDLMCSDVKLISSRECKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDT
L
QGLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETMKTHR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser