NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21145.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21145.1 Public Mus musculus 7 Cebpa 21 106 86 CCDS HistoryNCBI Gene:12606Re-query CCDS DB by CCDS ID:21145.1Re-query CCDS DB by GeneID:12606See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21145.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000042985 ENSMUSP00000096129 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000042985Link to Ensembl Protein Viewer:ENSMUSP00000096129Re-query CCDS DB by Nucleotide ID:ENSMUST00000042985Re-query CCDS DB by Protein ID:ENSMUSP00000096129
Original member Current member EBI,WTSI OTTMUST00000142810 OTTMUSP00000074467 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000142810Link to Vega Protein Viewer:OTTMUSP00000074467Re-query CCDS DB by Nucleotide ID:OTTMUST00000142810Re-query CCDS DB by Protein ID:OTTMUSP00000074467
Original member Current member NCBI NM_007678.3 NP_031704.2 Accepted alive Link to Nucleotide Sequence:NM_007678.3Link to Protein Sequence:NP_031704.2Re-query CCDS DB by Nucleotide ID:NM_007678Re-query CCDS DB by Protein ID:NP_031704Link to BLAST:NP_031704.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031704.2 359 P53566-1 359 100% 0 0

Chromosomal Locations for CCDS 21145.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 35119419 35120498 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1080 nt):
ATGGAGTCGGCCGACTTCTACGAGGTGGAGCCGCGGCCCCCGATGAGCAGTCACCTCCAGAGCCCCCCGC
AC
GCGCCCAGCAACGCCGCCTTTGGCTTTCCCCGGGGCGCGGGCCCCGCGCCGCCCCCAGCCCCACCTGC
C
GCCCCGGAGCCGCTGGGCGGCATCTGCGAGCACGAGACGTCTATAGACATCAGCGCCTACATCGACCCG
GCC
GCCTTCAACGACGAGTTCCTGGCCGACCTCTTCCAGCACAGCCGACAGCAGGAGAAGGCCAAGGCGG
CG
GCGGGCCCCGCGGGTGGCGGCGGTGACTTTGACTACCCGGGAGCCCCGGCGGGCCCCGGCGGCGCGGT
C
ATGTCCGCGGGGGCGCACGGGCCCCCTCCCGGCTACGGCTGTGCGGCGGCCGGCTACCTGGACGGCAGG
CTG
GAGCCCCTGTACGAGCGCGTCGGGGCGCCCGCGCTACGGCCGCTGGTGATCAAACAAGAGCCCCGCG
AG
GAGGACGAGGCGAAGCAGCTGGCGCTGGCCGGCCTCTTCCCCTACCAGCCACCGCCGCCACCGCCACC
G
CCGCACCCGCACGCGTCTCCCGCGCACCTGGCCGCCCCCCACTTGCAGTTCCAGATCGCGCACTGCGGC
CAG
ACCACCATGCACCTGCAGCCTGGCCACCCCACACCGCCGCCCACGCCCGTGCCCAGCCCGCACGCTG
CG
CCCGCCTTGGGTGCTGCGGGCCTGCCTGGCCCCGGGAGCGCGCTCAAGGGCTTGGCCGGTGCGCACCC
C
GACCTCCGCACGGGAGGCGGCGGCGGTGGCAGCGGTGCCGGTGCGGGCAAAGCCAAGAAGTCGGTGGAC
AAG
AACAGCAACGAGTACCGGGTACGGCGGGAACGCAACAACATCGCGGTGCGCAAGAGCCGAGATAAAG
CC
AAACAACGCAACGTGGAGACGCAACAGAAGGTGCTGGAGTTGACCAGTGACAATGACCGCCTGCGCAA
G
CGGGTGGAACAGCTGAGCCGTGAACTGGACACGCTGCGGGGCATCTTCCGCCAGCTGCCTGAGAGCTCC
TTG
GTCAAGGCCATGGGCAACTGCGCGTGA


Translation (359 aa):
MESADFYEVEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHETSIDISAYIDP
A
AFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSAGAHGPPPGYGCAAAGYLDGR
L
EPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPPHPHASPAHLAAPHLQFQIAHCG
Q
TTMHLQPGHPTPPPTPVPSPHAAPALGAAGLPGPGSALKGLAGAHPDLRTGGGGGGSGAGAGKAKKSVD
K
NSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESS
L
VKAMGNCA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser