NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS20766.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20766.1 Public Mus musculus 7 Vmn1r64 23 108 98 CCDS HistoryNCBI Gene:404285Re-query CCDS DB by CCDS ID:20766.1Re-query CCDS DB by GeneID:404285See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 20766.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000078475.4 ENSMUSP00000077568.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000078475.4Link to Ensembl Protein Viewer:ENSMUSP00000077568.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000078475Re-query CCDS DB by Protein ID:ENSMUSP00000077568
Original member Current member NCBI NM_207544.1 NP_997427.1 Accepted alive Link to Nucleotide Sequence:NM_207544.1Link to Protein Sequence:NP_997427.1Re-query CCDS DB by Nucleotide ID:NM_207544Re-query CCDS DB by Protein ID:NP_997427Link to BLAST:NP_997427.1

Chromosomal Locations for CCDS 20766.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 5883580 5884542 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (963 nt):
ATGTTGTCTCAGAATAAAACCCTAAAAACCATGGAAGTGTTGGCTCTTCAGATCCTTTTGCTTTGCCAGG
TT
GTGGTTGGGACTGTGGGCAACATCTTTCTGTTTGTCCATAATTTCTCTCCAGTCTTGACTGACTCCCG
A
CTGAGGCCCATACAGGTCATTCTAATCAACTTGGCTGTAGCCAATGCATTCATGCTCCTTCTGTTTGCA
TAT
TCATATGACCTGATTGATTTTGTTCCCAGGAAGCCTCCAACTGACCTCAAATGTAAACTTGCATACT
TC
TTTAACATGGTGGCTCAAGGCACAATCATGTGCTCCACCTGTCTCCTCAGTACCTACCAGTTTGTCAC
T
CTTGTTCCTGGTAACTGGGCTAGGGTTATGTTCAGAGAAATATCCCCCAAGGTTGTGAGCTATTGTTGT
TAC
AGCTGCTGGTTGTTCAGTGTCTTAAATAATGCTTACATGCCAATGTATGTCAGTGGTCCACAGAAAA
CA
CACAATGACTCTGATTCTAAAGACAATTGGATATGCTCCATCTCTGGGGTCAGTGTAGACATGAATTT
C
TTGCGGTTTTCCCATGACATCATATTCATTGGCATCATGGCTTGGACCAGTGTCTCCATGGTGATTCAC
CTA
AACAGACACCACCACAGAATGCATTACCTGCATAATCCTAATCAGATCAACAGAGGCCATGCTGAGA
CC
AAAGCAGCCCACACCATCATGATGCTGGTGGTCACATTTGTGAGCTTATATATTCTAGATTGTATTTG
T
AGTTTATTTCACATTTCCTTTGTGGAATCTCGTCTTTGGTTAATAGATGTCATAGAACTTTTGCATCTA
AGC
TTCCCCACTGTTTCTCCCTTCCTGTTGATTTGTAGGGATCCTATGGGTCCTTGTTCTCTGCTTTTCA
TT
GTGGGTCTGGAAATCCACGTGACTGTGGGAGCCATTACAGAGGAACAGTAA


Translation (320 aa):
MLSQNKTLKTMEVLALQILLLCQVVVGTVGNIFLFVHNFSPVLTDSRLRPIQVILINLAVANAFMLLLFA
Y
SYDLIDFVPRKPPTDLKCKLAYFFNMVAQGTIMCSTCLLSTYQFVTLVPGNWARVMFREISPKVVSYCC
Y
SCWLFSVLNNAYMPMYVSGPQKTHNDSDSKDNWICSISGVSVDMNFLRFSHDIIFIGIMAWTSVSMVIH
L
NRHHHRMHYLHNPNQINRGHAETKAAHTIMMLVVTFVSLYILDCICSLFHISFVESRLWLIDVIELLHL
S
FPTVSPFLLICRDPMGPCSLLFIVGLEIHVTVGAITEEQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser