NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS20665.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20665.1 Public Mus musculus 6 Eps8 21 106 86 CCDS HistoryNCBI Gene:13860Re-query CCDS DB by CCDS ID:20665.1Re-query CCDS DB by GeneID:13860See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 20665.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000058210 ENSMUSP00000052776 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000058210Link to Ensembl Protein Viewer:ENSMUSP00000052776Re-query CCDS DB by Nucleotide ID:ENSMUST00000058210Re-query CCDS DB by Protein ID:ENSMUSP00000052776
Original member Current member EBI,WTSI ENSMUST00000100841 ENSMUSP00000098402 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000100841Link to Ensembl Protein Viewer:ENSMUSP00000098402Re-query CCDS DB by Nucleotide ID:ENSMUST00000100841Re-query CCDS DB by Protein ID:ENSMUSP00000098402
Original member Current member EBI,WTSI ENSMUST00000111878 ENSMUSP00000107509 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111878Link to Ensembl Protein Viewer:ENSMUSP00000107509Re-query CCDS DB by Nucleotide ID:ENSMUST00000111878Re-query CCDS DB by Protein ID:ENSMUSP00000107509
Original member Current member EBI,WTSI OTTMUST00000054652 OTTMUSP00000026105 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000054652Link to Vega Protein Viewer:OTTMUSP00000026105Re-query CCDS DB by Nucleotide ID:OTTMUST00000054652Re-query CCDS DB by Protein ID:OTTMUSP00000026105
Original member Current member EBI,WTSI OTTMUST00000054653 OTTMUSP00000026106 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000054653Link to Vega Protein Viewer:OTTMUSP00000026106Re-query CCDS DB by Nucleotide ID:OTTMUST00000054653Re-query CCDS DB by Protein ID:OTTMUSP00000026106
Original member Current member EBI,WTSI OTTMUST00000054655 OTTMUSP00000026108 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000054655Link to Vega Protein Viewer:OTTMUSP00000026108Re-query CCDS DB by Nucleotide ID:OTTMUST00000054655Re-query CCDS DB by Protein ID:OTTMUSP00000026108
Original member Current member NCBI NM_001271588.1 NP_001258517.1 Accepted alive Link to Nucleotide Sequence:NM_001271588.1Link to Protein Sequence:NP_001258517.1Re-query CCDS DB by Nucleotide ID:NM_001271588Re-query CCDS DB by Protein ID:NP_001258517Link to BLAST:NP_001258517.1
Original member Current member NCBI NM_001271595.1 NP_001258524.1 Accepted alive Link to Nucleotide Sequence:NM_001271595.1Link to Protein Sequence:NP_001258524.1Re-query CCDS DB by Nucleotide ID:NM_001271595Re-query CCDS DB by Protein ID:NP_001258524Link to BLAST:NP_001258524.1
Original member Current member NCBI NM_007945.3 NP_031971.2 Accepted alive Link to Nucleotide Sequence:NM_007945.3Link to Protein Sequence:NP_031971.2Re-query CCDS DB by Nucleotide ID:NM_007945Re-query CCDS DB by Protein ID:NP_031971Link to BLAST:NP_031971.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001258517.1 821 Q08509 821 100% 0 0
NP_001258524.1 821 Q08509 821 100% 0 0
NP_031971.2 821 Q08509 821 100% 0 0

Chromosomal Locations for CCDS 20665.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 137479016 137479129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137482152 137482281 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137483542 137483722 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137490217 137490439 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137499582 137499725 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137500535 137500643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137505388 137505521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137509082 137509262 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137512149 137512297 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137514278 137514352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137514703 137514791 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137517071 137517197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137519443 137519516 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137522153 137522289 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137522830 137522912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137527088 137527237 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137527368 137527529 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137528525 137528592 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137537618 137537694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 137539322 137539380 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2466 nt):
ATGAATGGTCATATGTCTAACCGCTCCAGTGGGTATGGAGTCTACCCTTCTCAACTGAATGGTTACGGAT
CT
TCACCACCCTATTCCCAGATGGACAGAGAACACAGCTCAAGAACAAGTGCAAAGGCCCTTTATGAACA
A
AGGAAGAACTATGCCCGAGACAGTGTCAGCAGTGTGTCGGACGTGTCCCAGTACCGCGTGGAACACTTG
ACC
ACCTTCGTGCTGGATCGGAAAGATGCAATGATCACTGTCGAGGACGGAATAAGAAAGCTGAAGTTGC
TG
GATGCCAAGGGCAAAGTGTGGACTCAAGATATGATTCTCCAAGTGGATGACCGAGCTGTGAGCCTGAT
T
GACTTAGAGTCAAAGAATGAATTGGAGAATTTTCCTCTAAACACAATCTCGCATTGTCAAGCAGTGGTA
CAT
GCATGCAGCTATGACTCCATTCTCGCCTTGGTATGCAAAGAGCCAACGCAGAGCAAGCCAGACCTTC
AC
CTTTTCCAGTGTGATGAGGTTAAGGCAAACCTAATTAGTGAAGATATCGAAAGTGCAATCAGTGACAG
T
AAAGGTGGGAAACAGAAGAGGCGGCCGGAGGCCCTGAGGATGATTGCCAAAGCAGATCCTGGCATCCCT
CCT
CCTCCCAGAGCTCCTGCCCCTGTGCCACCAGGGACTGTCACACAGGTGGACGTTAGGAGTCGCGTAG
CA
GCCTGGTCTGCCTGGGCAGCTGACCAGGGCGACTTCGAGAAGCCCCGGCAGTACCACGAGCAAGAAGA
G
ACGCCCGAGATGATGGCAGCCCGGATCGACAGGGATGTGCAAATCTTAAACCATATTTTGGATGACATT
GAA
TTTTTTATCACCAAACTCCAAAAAGCCGCCGAAGCGTTTTCTGAGCTTTCTAAAAGGAAGAAAAGTA
AG
AAAAGTAAAAGGAAAGGACCTGGAGAGGGCGTTTTAACACTGAGGGCAAAACCGCCACCTCCTGATGA
A
TTTGTTGACTGTTTCCAGAAGTTTAAACATGGATTCAACCTTCTGGCCAAGTTGAAGTCCCATATCCAG
AAC
CCGAGTGCTTCAGATCTGGTTCATTTTTTGTTTACTCCACTAAATATGGTGGTCCAGGCAACAGGTG
GC
CCCGAACTGGCCAGTTCGGTACTCAGCCCACTGTTGACAAAAGACACAGTTGATTTCTTAAACTACAC
A
GCCACTGCGGAGGAACGGAAGCTGTGGATGTCACTGGGAGATAGTTGGGTGAAAGTGAGAGCAGAGTGG
CCG
AAAGAACAGTTCATCCCACCTTACGTCCCGAGGTTCCGCAACGGCTGGGAGCCCCCGATGCTGAACT
TC
ATGGGCGCGCCCACAGAGCAAGACATGTATCAACTGGCCGAGTCCGTGGCCAACGCAGAACACCAGCG
C
AAACAGGACAGCAAGAGGCTGTCCACAGAGCATTCCAATGTGTCCGACTATCCTCCAGCCGACGGATAT
GCG
TACAGTAGCAGCATGTACCACAGAGGACCACATGCAGACCACGGGGAGGCTGCCATGCCTTTCAAGT
CA
ACTCCTAATCACCAAGTAGATAGGAATTATGACGCAGTCAAAACACAACCCAAGAAATACGCCAAATC
C
AAGTACGACTTTGTGGCGAGGAACAGCAGCGAGCTCTCGGTTATGAAAGATGATGTCTTAGAGATACTC
GAC
GATCGAAGGCAGTGGTGGAAAGTCCGGAATGCCAGTGGAGACTCTGGGTTTGTGCCAAATAACATTC
TG
GATATCATGAGAACTCCGGAATCTGGAGTGGGGCGCGCTGACCCCCCATACACACATACCATACAGAA
A
CAAAGGACGGAATACGGCCTGAGATCAGCTGACACTCCTTCTGCCCCATCACCCCCTCCAACGCCAGCA
CCC
GTTCCGGTCCCCCTTCCACCTTCTGTACCAGCACCCGTTTCTGTGCCCAAGGTCCCAGCCAATGTCA
CC
CGCCAGAACAGCAGCTCCAGTGACAGTGGGGGCAGCATTGTGCGGGACAGCCAGAGATACAAACAACT
C
CCAGTGGACCGAAGGAAGTCCCAGATGGAAGAGGTTCAGGATGAGCTCTTCCAGAGGCTGACCATCGGG
CGC
AGTGCTGCACAGAGGAAGTTCCACGTGCCACGGCAGAACGTTCCAGTGATCAATATCACTTATGACT
CC
TCACCGGAAGAAGTAAAGACTTGGCTGCAGTCAAAGGGATTCAACCCCGTGACTGTCAATAGCCTCGG
G
GTGTTGAACGGAGCACAACTCTTTTCTCTCAACAAAGACGAACTGAGGTCTGTCTGCCCGGAAGGTGCC
AGA
GTCTTTAACCAAATCACTGTTCAGAAAGCTGCTTTGGAGGACAGTAATGGAAGCTCCGAGTTACAAG
AG
ATCATGCGGAGACGGCAGGAGAAGATCAGCGCCGCTGCGAGCGACTCGGGAGTGGAGTCTTTCGATGA
A
GGGAGCAGCCACTGA


Translation (821 aa):
MNGHMSNRSSGYGVYPSQLNGYGSSPPYSQMDREHSSRTSAKALYEQRKNYARDSVSSVSDVSQYRVEHL
T
TFVLDRKDAMITVEDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESK
NELENFPLNTISHCQAVV
H
ACSYDSILALVCKEPTQSKPDLHLFQCDEVK
ANLISEDIESAISDSKGGKQKRRPEALRMIAKADPGIP
P
PPRAPAPVPPGTVTQVDVRSRVAAWSAWAADQGD
FEKPRQYHEQEETPEMMAARIDRDVQILNHILDDI
E
FFITKLQKAAEAFSELSKRKKSKKSKRKGPG
EGVLTLRAKPPPPDEFVDCFQKFKHGFNLLAKLKSHIQ
N
PSASDLVHFLFTPLNM
VVQATGGPELASSVLSPLLTKDTVDFLNYTATAEERKLWMSLGDSWVKVRAEW
P
KEQFIPPYVPRFRNGWEPPMLNFMGAPTEQDMYQLAESVANAEHQRKQDSKRLSTE
HSNVSDYPPADGY
A
YSSSMYHRGPHADHGEAAMPFKSTPNHQVD
RNYDAVKTQPKKYAKSKYDFVARNSSELSVMKDDVLEIL
D
DRRQWWKVRNASGDSGFVPNNILDIMRTPESGVGRADPPYTHTIQ
KQRTEYGLRSADTPSAPSPPPTPA
P
VPVPLPPSVPAPVSVPKVPANVTRQNSSSSDSGGSIVRDSQRYKQLPVD
RRKSQMEEVQDELFQRLTIG
R
SAAQRKFHVPRQNVPVINITYDSSPEEVKTWLQSKGFNP
VTVNSLGVLNGAQLFSLNKDELRSVCPEGA
R
VFNQITVQKAALE
DSNGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser