NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS20513.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20513.1 Public Mus musculus 6 Clec4d 23 108 98 CCDS HistoryNCBI Gene:17474Re-query CCDS DB by CCDS ID:20513.1Re-query CCDS DB by GeneID:17474See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 20513.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000032240.3 ENSMUSP00000032240.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000032240.3Link to Ensembl Protein Viewer:ENSMUSP00000032240.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000032240Re-query CCDS DB by Protein ID:ENSMUSP00000032240
Original member Current member NCBI NM_010819.4 NP_034949.3 Accepted alive Link to Nucleotide Sequence:NM_010819.4Link to Protein Sequence:NP_034949.3Re-query CCDS DB by Nucleotide ID:NM_010819Re-query CCDS DB by Protein ID:NP_034949Link to BLAST:NP_034949.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034949.3 219 Q9Z2H6 219 100% 0 0

Chromosomal Locations for CCDS 20513.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 123262335 123262362 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 123265319 123265411 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 123267055 123267162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 123267992 123268143 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 123270281 123270396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 123274658 123274820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (660 nt):
ATGTGGCTGGAAGAATCCCAAATGAAATCAAAAGGTACCCGACATCCCCAACTGATCCCTTGCGTCTTCG
CT
GTTGTTTCCATCTCGTTCCTTAGTGCTTGCTTTATTTCAACTTGTTTGGTGACTCATCATTACTTTTT
A
CGCTGGACGAGAGGAAGTGTGGTGAAACTGTCAGACTACCACACGAGAGTAACGTGCATCCGAGAGGAG
CCA
CAGCCTGGAGCTACAGGAGGTACTTGGACCTGCTGTCCTGTTAGCTGGAGAGCCTTCCAGTCTAACT
GT
TACTTTCCTCTTAATGACAACCAGACCTGGCATGAGAGCGAGAGGAACTGCTCAGGGATGAGCAGTCA
T
CTGGTGACCATCAACACCGAAGCAGAACAGAATTTTGTGACCCAGCTTTTGGATAAACGGTTTTCTTAT
TTC
CTGGGACTTGCTGATGAGAATGTGGAAGGCCAATGGCAGTGGGTGGACAAGACGCCATTTAACCCAC
AC
ACGGTATTCTGGGAAAAGGGGGAATCCAATGACTTTATGGAAGAAGACTGTGTTGTCCTTGTTCATGT
C
CATGAAAAATGGGTCTGGAATGACTTTCCTTGTCACTTTGAGGTGAGAAGGATTTGTAAATTACCTGGA
ATA
ACATTCAATTGGAAGCCCTCGAAGTGA


Translation (219 aa):
MWLEESQMKSKGTRHPQLIPCVFAVVSISFLSACFISTCLVTHHYFLRWTRGSVVKLSDYHTRVTCIREE
P
QPGAT
GGTWTCCPVSWRAFQSNCYFPLNDNQTWHESERNCSGMSSHLVTINTEAEQNFVTQLLDKRFSY
F
LGLADENVEGQWQWVDKTPFNPHT
VFWEKGESNDFMEEDCVVLVHVHEKWVWNDFPCHFEVRRICKLPG
I
TFNWKPSK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser