NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20417.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20417.1 Public Mus musculus 6 Arpc4 21 106 86 CCDS HistoryNCBI Gene:68089Re-query CCDS DB by CCDS ID:20417.1Re-query CCDS DB by GeneID:68089See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 20417.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000156898 ENSMUSP00000114839 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000156898Link to Ensembl Protein Viewer:ENSMUSP00000114839Re-query CCDS DB by Nucleotide ID:ENSMUST00000156898Re-query CCDS DB by Protein ID:ENSMUSP00000114839
Original member Current member EBI,WTSI OTTMUST00000039414 OTTMUSP00000017609 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000039414Link to Vega Protein Viewer:OTTMUSP00000017609Re-query CCDS DB by Nucleotide ID:OTTMUST00000039414Re-query CCDS DB by Protein ID:OTTMUSP00000017609
Original member Current member NCBI NM_026552.3 NP_080828.1 Accepted alive Link to Nucleotide Sequence:NM_026552.3Link to Protein Sequence:NP_080828.1Re-query CCDS DB by Nucleotide ID:NM_026552Re-query CCDS DB by Protein ID:NP_080828Link to BLAST:NP_080828.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080828.1 168 P59999 168 100% 0 0

Chromosomal Locations for CCDS 20417.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 113378206 113378208 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 113380726 113380844 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 113381963 113382074 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 113384082 113384177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 113385490 113385660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 113388771 113388776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (507 nt):
ATGACTGCCACTCTCCGCCCCTACCTTAGTGCCGTGCGGGCCACGCTGCAGGCTGCTCTCTGCCTGGAGA
AC
TTCTCCTCCCAGGTCGTGGAACGACACAACAAGCCAGAGGTCGAAGTCAGGAGTAGCAAAGAACTGCT
A
TTACAGCCTGTCACCATCAGCAGGAATGAGAAGGAAAAGGTTCTTATTGAAGGCTCCATCAACTCTGTC
CGG
GTCAGCATTGCTGTGAAGCAGGCCGATGAAATTGAGAAGATTTTATGCCATAAATTCATGCGCTTCA
TG
ATGATGCGAGCAGAGAACTTCTTTATCCTTCGAAGGAAACCTGTGGAGGGATATGACATCAGCTTTCT
C
ATCACCAACTTCCACACGGAGCAGATGTACAAACACAAGCTGGTGGACTTTGTAATCCACTTCATGGAG
GAG
ATCGACAAGGAGATCAGTGAGATGAAGCTGTCGGTCAATGCCCGGGCTCGTATCGTAGCTGAGGAGT
TC
CTCAAGAATTTTTAA


Translation (168 aa):
MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEKVLIEGSINSV
R
VSIAVKQ
ADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFME
E
IDKEISEMKLSVNARARIVAEEFLKN
F



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser