NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20324.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20324.1 Public Mus musculus 6 Aplf 21 106 86 CCDS HistoryNCBI Gene:72103Re-query CCDS DB by CCDS ID:20324.1Re-query CCDS DB by GeneID:72103See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 20324.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000065997 ENSMUSP00000066232 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000065997Link to Ensembl Protein Viewer:ENSMUSP00000066232Re-query CCDS DB by Nucleotide ID:ENSMUST00000065997Re-query CCDS DB by Protein ID:ENSMUSP00000066232
Original member Current member EBI,WTSI OTTMUST00000140846 OTTMUSP00000073697 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000140846Link to Vega Protein Viewer:OTTMUSP00000073697Re-query CCDS DB by Nucleotide ID:OTTMUST00000140846Re-query CCDS DB by Protein ID:OTTMUSP00000073697
Original member Current member NCBI NM_024251.4 NP_077213.2 Accepted alive Link to Nucleotide Sequence:NM_024251.4Link to Protein Sequence:NP_077213.2Re-query CCDS DB by Nucleotide ID:NM_024251Re-query CCDS DB by Protein ID:NP_077213Link to BLAST:NP_077213.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_077213.2 478 Q9D842-3 478 100% 0 0

Chromosomal Locations for CCDS 20324.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 87629994 87630175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 87636930 87636976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 87641890 87642015 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 87646014 87646351 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 87653708 87653892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 87658433 87658565 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 87658841 87658988 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 87663685 87663857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 87668416 87668487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 87671990 87672022 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1437 nt):
ATGCCCAGCGTGCCTGAGGGAGGTGGCTACGAGATAACAGACAAAAGAGTATCCAGAAGACATGCCATTC
TT
GAAGTGGTTGATAGTCAGCTTCGAATCAAGCCAATCCATAGGAATCCATGTTTCTACCAGTCCTCGGA
G
AAGAGCCAACACTCGCCAATGGAGACGCAAGTGTGGAGCCAGTTGCATCCCGGGGATAGCTTTTCCCTG
TTA
CTTGACAAGTACGCTTTCCGTGTTTTCTCTGCAGAATCTGAAGTGGAGATGGAGTGTACTCTGAGAA
AC
AGTCAGATGCTTGATGAAGATGATATATTGAGTGAGATGCAGAAGTCCCCTGTGGTTAACTTACCTGA
T
AAGACAACTGGTGCCTCACAGCTGCAAGGAAGCCCTGAAATAACCAAGACCAAGTGTCCCACCATAGAT
CCT
ATGTCCTCTTCAGGTGAATGCAGAGCTTTCAGTGAGCACCAGCCACGTCCTACCCAGAGGAAAAGAA
TC
CTCCCAGCTTGGATGTTGGCGGAAAGTCTAAGTGACCAGAGCCTCTCCACACCAGCTGAGGGGGGAGA
T
AAGGATGTCATCCAGAGGAGTGGAAAAGCAGGAACCTGTGAAGATAGAACCCCAGGAAACACATCATGG
CAT
GGGAAAAAGCGGCTTAGTCCATCAGGAAATTCAAAAAGTGTGTCAGCGGAACAAGACCCTGGGAAGA
AG
TGCAGAAAGGCTGACCAAGAAGGACCGGGTGTTTCTTCTGAGAATGTTCCAGAATCATCATCTTCAAA
C
ATAGTAAAGGACCCAGATGTGGATATTGTGAAGACAAATAAACAGAAGGACGGGATTTTAATAGAGGAA
CTT
GGTGAGGTCTCTAAACATAAAGCCGCCACCAAACCAACCACAAATGAAGAGGGCGAGAGTTGTGCAC
GT
GTCCAAAGCAAGTCACCTCCTGAGAAATCTCAAGGATGCCATCCTGAGTCTAGCTCTGCTCCCTCCAG
T
CCTGATGCTTTGCACACAGACACAGCTGACCCAGTGCTGGGCTGTTCAGAAGAAAGCAAGGTCCGGAGG
ACG
GCCTGCATGTATGGGGCCAACTGCTACAGGAGGAACCCCCTCCACTTTCAACACTTCAGCCACCCTG
GT
GACAGTGACTATGGAGAGGTACATGGCACAGATGAAGGTGTGATTGGTGACAGGCCCGAGTGTCCCTA
T
GGAGCGTCTTGTTACAGGAAGAACCCCCAGCACAAGATGGAATATAGGCACAGTGCACTTCCAGCCAGA
GTT
GCTCTGGATGAAGATGACGATGATGTCGGGCAACCCAGTGACGATGAGGACGAGGAAGACTATGAGC
CG
ACAGATGAAGATTCTGATTGGCACCCAGGAAAGGACGATGAGGAGCAGGAAGATGTGGATGAGCTTTT
G
AAAGAAGCAAAAAGGTTTATGAGAAGGAAAAAGTAG


Translation (478 aa):
MPSVPEGGGYEITDKRVSRRHAILEVVDSQLRIKPIHRNPCFYQSSEKSQHSPMETQVWSQLHPGDSFSL
L
LDKYAFRVFSAESEVEMECTL
RNSQMLDEDDILSEMQKSPVVNLPDKTTGASQLQGSPEITKTKCPTID
P
M
SSSGECRAFSEHQPRPTQRKRILPAWMLAESLSDQSLSTPAEGGDKDVIQRSGKAGTCEDRTPGNTSW
H
GKKRLSPSGNSKSVSAEQDPGKKCRKADQEGPGVSSE
NVPESSSSNIVKDPDVDIVKTNKQKDGILIEE
L
GEVSKHKAATKPTTNEEGESCARVQSKSPPEKSQGCHPESSSAPSSPDALHTDTADPVLGCSEESKVRR
T
ACMYGANCY
RRNPLHFQHFSHPGDSDYGEVHGTDEGVIGDRPECPYGASCYRKNPQHKMEYRHSALPAR
V
ALDEDDDDVGQPSDDEDEEDYEPTDEDSDWHPGKDDEEQEDVDELLKEAKRFMRRKK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser