NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS2032.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2032.1 Public Homo sapiens 2 COX5B 22 109 92 CCDS HistoryNCBI Gene:1329Re-query CCDS DB by CCDS ID:2032.1Re-query CCDS DB by GeneID:1329See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 2032.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000258424.2 ENSP00000258424.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000258424.2Link to Ensembl Protein Viewer:ENSP00000258424.2Re-query CCDS DB by Nucleotide ID:ENST00000258424Re-query CCDS DB by Protein ID:ENSP00000258424
Original member NCBI NM_001862.2 NP_001853.2 Updated not alive Link to Nucleotide Sequence:NM_001862.2Link to Protein Sequence:NP_001853.2Re-query CCDS DB by Nucleotide ID:NM_001862Re-query CCDS DB by Protein ID:NP_001853
Current member NCBI NM_001862.3 NP_001853.2 Accepted alive Link to Nucleotide Sequence:NM_001862.3Link to Protein Sequence:NP_001853.2Re-query CCDS DB by Nucleotide ID:NM_001862Re-query CCDS DB by Protein ID:NP_001853Link to BLAST:NP_001853.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001853.2 129 P10606 129 100% 0 0

Chromosomal Locations for CCDS 2032.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 97646087 97646189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 97647067 97647140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 97647344 97647443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 97647996 97648108 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (390 nt):
ATGGCTTCAAGGTTACTTCGCGGAGCTGGAACGCTGGCCGCGCAGGCCCTGAGGGCTCGCGGCCCCAGTG
GC
GCGGCCGCGATGCGCTCCATGGCATCTGGAGGTGGTGTTCCCACTGATGAAGAGCAGGCGACTGGGTT
G
GAGAGGGAGATCATGCTGGCTGCAAAGAAGGGACTGGACCCATACAATGTACTGGCCCCAAAGGGAGCT
TCA
GGCACCAGGGAAGACCCTAATTTAGTCCCCTCCATCTCCAACAAGAGAATAGTAGGCTGCATCTGTG
AA
GAGGACAATACCAGCGTCGTCTGGTTTTGGCTGCACAAAGGCGAGGCCCAGCGATGCCCCCGCTGTGG
A
GCCCATTACAAGCTGGTGCCCCAGCAGCTGGCACACTGA


Translation (129 aa):
MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGA
S
GTREDPNLVPSISNKRIVGCI
CEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser