NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19966.3 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19966.3 Public Mus musculus 6 Ahcyl2 23 108 98 CCDS HistoryNCBI Gene:74340Re-query CCDS DB by CCDS ID:19966.3Re-query CCDS DB by GeneID:74340See the combined annotation on chromosome 6 in Sequence Viewer

Public Note for CCDS 19966.2
This CCDS representation uses the most likely start codon based on currently available transcript evidence from mouse and other homologs. However, it should be noted that two other potential upstream start codons exist, both of which are conserved and have strong Kozak signals. The use of these start codons would result in a protein that is 37 aa or 30 aa longer at the N-terminus, respectively. The 5'-most start codon has no transcript support in any species, while only one mouse mRNA, AK165725.1, extends far enough to include the second start codon, which occurs very close to the 5' end. If the transcription start site is at or around this region, the ribosome may not be able to initiate translation there. Alternatively, the region is very GC-rich, so it is also possible that cloning difficulties, e.g., reverse transcriptase pausing, did not allow the true transcription start site to be identified. Due to uncertainty about the location of both the transcription and translation initiation sites, the third start codon is therefore represented based on currently available evidence.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 19966.3

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000115242.8 ENSMUSP00000110897.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115242.8Link to Ensembl Protein Viewer:ENSMUSP00000110897.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000115242Re-query CCDS DB by Protein ID:ENSMUSP00000110897
Original member Current member NCBI NM_021414.6 NP_067389.5 Accepted alive Link to Nucleotide Sequence:NM_021414.6Link to Protein Sequence:NP_067389.5Re-query CCDS DB by Nucleotide ID:NM_021414Re-query CCDS DB by Protein ID:NP_067389Link to BLAST:NP_067389.5

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067389.5 613 Q68FL4-1 613 100% 0 0

Chromosomal Locations for CCDS 19966.3

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 29768538 29768906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29863140 29863251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29870568 29870711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29871186 29871286 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29878529 29878631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29880549 29880643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29883623 29883729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29886118 29886234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29890681 29890744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29891201 29891289 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29894819 29894889 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29896322 29896416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29903189 29903287 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29906508 29906576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29906681 29906759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29908347 29908467 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29909040 29909046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1842 nt):
ATGTCGGTGCAGGTTGTGTCAGCAGCGGCAGCCGCCAAGGTGCCTGAGGTGGAGCTGAAGGATCTGAGCC
CC
TCCGAGGCGGAGCCCCAGTTGGGACTGAGCGCGGCGGCCGTGGGCGCCATGGTACCCCCAGCGGGTGG
C
GGGGACCCAGAGGCTCCAGCTCCGGCTCCCGCGGCGGAGCGGCCCCCGGCCCCCGGCCCGGGCTCGGGG
CCC
ACCGCGGCTCTGAGCCCTGCGGCCGGGAAGGTCCCTCAAGCGTCCGCCATGAAGCGGAGCGACCCTC
AT
CACCAGCACCAGCGGCATCGCGACGGCGGCGAGGCCTTGGTCAGCCCCGACGGCACGGTCACCGAGGC
G
CCGCGCACGGTCAAGAAGCAGATTCAGTTTGCTGACCAGAAGCAGGAATTCAACAAACGTCCCACCAAA
ATC
GGACGTCGCTCTTTGTCTCGTTCCATCTCTCAGTCATCTACTGACAGCTATAGCTCAGCTGCCTCAT
AT
ACAGATAGCTCTGACGATGAGACATCCCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGTAGCGA
C
TTCTGTGTCAAGAACATCAAACAAGCGGAGTTTGGACGCAGAGAAATTGAAATTGCTGAGCAAGAGATG
CCT
GCCTTGATGGCTTTAAGGAAGAGAGCCCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATTGTGGGTT
GT
ACGCACATCACTGCTCAGACAGCCGTGCTTATGGAGACACTGGGTGCTCTGGGGGCACAGTGCCGATG
G
GCTGCCTGCAACATCTACTCCACCCTCAATGAAGTGGCTGCTGCTCTCGCAGAAAGTGGGTTTCCCGTC
TTT
GCCTGGAAAGGAGAATCAGAAGATGACTTTTGGTGGTGCATTGACAGATGCGTGAATGTGGAGGGCT
GG
CAGCCAAACATGATACTGGATGATGGAGGAGATCTGACTCACTGGATTTATAAAAAGTATCCCAACAT
G
TTTAAAAAAATCAAAGGCATAGTCGAGGAGAGTGTTACTGGAGTCCATAGGCTGTACCAACTGTCCAAA
GCT
GGGAAGCTGTGTGTTCCCGCCATGAACGTCAATGACTCAGTCACTAAGCAGAAATTTGATAACCTCT
AC
TGTTGCCGTGAATCTATTCTTGACGGACTTAAAAGGACAACAGATATGATGTTTGGTGGAAAGCAGGT
G
GTGGTCTGTGGCTATGGAGAGGTGGGAAAGGGGTGCTGCGCTGCTCTGAAAGCCATGGGCTCCATTGTG
TAC
GTGACTGAGATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTCCGACTAGTGAAGCTGA
AT
GAAGTCATCCGACAGGTCGACATTGTTATTACTTGCACAGGGAACAAGAATGTGGTAACCAGAGAGCA
C
TTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGCCATTCCAACACCGAGATTGATGTGGCC
AGC
CTGCGGACACCAGAACTGACCTGGGAGAGAGTAAGATCCCAAGTTGATCATGTGATATGGCCTGATG
GC
AAGAGGATAGTACTGCTGGCAGAGGGCCGTCTACTGAATCTCAGCTGCTCCACAGTGCCTACATTTGT
G
CTCTCCATCACTGCTACCACTCAGGCTCTCGCCTTGATAGAACTTTACAATGCTCCTGAGGGTCGCTAT
AAG
CAAGATGTGTACCTGCTACCCAAGAAAATGGATGAGTATGTGGCAAGCCTACACCTGCCCACCTTTG
AT
GCCCACCTGACAGAGCTAACAGATGAACAAGCCAAGTATCTGGGACTCAACAAGAATGGACCCTTCAA
G
CCTAACTACTACAGGTATTAA


Translation (613 aa):
MSVQVVSAAAAAKVPEVELKDLSPSEAEPQLGLSAAAVGAMVPPAGGGDPEAPAPAPAAERPPAPGPGSG
P
TAALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKK
QIQFADQKQEFNKRPTK
I
GRRSLSRSISQSSTDSYSS
AASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEM
P
ALMALRKRAQGEKPLAGAKIVGCTHITAQTA
VLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPV
F
AWKGESEDDFWWCIDRCVNVEGWQPNM
ILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSK
A
GKLCVPAMNVNDSVTKQKFDNLYCCRESILD
GLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIV
Y
VTEIDPICALQA
CMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVA
S
LRTPELTWERVRSQVDHVIWPDGKRIVLLAE
GRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRY
K
QDVYLLPKKM
DEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser