NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, February 27, 2024, starting at 8:00 a.m. EST for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS19638.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19638.1 Public Mus musculus 5 Aldh2 23 108 98 CCDS HistoryNCBI Gene:11669Re-query CCDS DB by CCDS ID:19638.1Re-query CCDS DB by GeneID:11669See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19638.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000031411.14 ENSMUSP00000031411.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031411.14Link to Ensembl Protein Viewer:ENSMUSP00000031411.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000031411Re-query CCDS DB by Protein ID:ENSMUSP00000031411
Original member Current member NCBI NM_009656.4 NP_033786.1 Accepted alive Link to Nucleotide Sequence:NM_009656.4Link to Protein Sequence:NP_033786.1Re-query CCDS DB by Nucleotide ID:NM_009656Re-query CCDS DB by Protein ID:NP_033786Link to BLAST:NP_033786.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033786.1 519 P47738 519 100% 0 0

Chromosomal Locations for CCDS 19638.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 121567991 121568023 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 121568926 121569040 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 121570604 121570761 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 121572017 121572181 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 121572676 121572860 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 121573423 121573525 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 121575091 121575204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 121575896 121576024 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 121576457 121576568 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 121578343 121578422 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 121579604 121579744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 121580614 121580718 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 121593362 121593481 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1560 nt):
ATGCTGCGCGCCGCACTCACCACTGTCCGCCGCGGACCGCGCCTGAGCCGCCTGTTGTCCGCCGCCGCCA
CC
AGCGCGGTGCCAGCCCCCAACCATCAGCCTGAGGTCTTCTGCAACCAGATCTTCATTAACAATGAGTG
G
CACGACGCCGTCAGCAGGAAAACATTTCCCACCGTCAACCCTTCCACAGGGGAGGTCATCTGCCAGGTG
GCC
GAAGGGAACAAGGAGGACGTAGACAAGGCAGTGAAGGCTGCTCGTGCAGCCTTCCAGCTGGGCTCGC
CC
TGGCGCCGCATGGATGCATCTGACCGGGGCCGGCTGTTGTACCGATTGGCGGATCTCATTGAACGGGA
C
CGGACCTACCTAGCGGCCTTGGAGACCCTGGACAACGGCAAGCCTTATGTCATCTCGTACCTGGTGGAT
TTG
GACATGGTCCTGAAATGTCTCCGCTATTACGCTGGCTGGGCTGACAAGTACCATGGGAAAACCATTC
CC
ATCGACGGCGACTTCTTCAGCTATACCCGCCATGAGCCTGTGGGCGTGTGTGGACAGATCATTCCGTG
G
AACTTCCCGCTCCTGATGCAAGCATGGAAACTGGGCCCAGCCCTGGCAACCGGGAACGTGGTGGTGATG
AAG
GTGGCCGAGCAGACACCGCTCACCGCGCTCTACGTGGCCAACTTGATCAAGGAGGCAGGCTTTCCCC
CT
GGCGTGGTCAATATCGTTCCCGGATTCGGCCCTACCGCCGGGGCTGCCATCGCATCCCATGAGGGTGT
G
GACAAAGTGGCGTTCACAGGCTCCACGGAGGTTGGTCACCTAATCCAGGTGGCCGCCGGGAGCAGCAAC
CTC
AAGAGAGTAACCCTGGAGCTGGGGGGAAAGAGTCCCAACATCATCATGTCCGACGCTGACATGGACT
GG
GCTGTGGAGCAGGCCCACTTTGCCCTGTTCTTCAACCAGGGCCAGTGCTGCTGCGCAGGCTCCCGGAC
C
TTCGTGCAGGAGAATGTGTATGACGAATTCGTGGAACGCAGCGTGGCTCGGGCCAAGTCTCGGGTGGTG
GGG
AACCCCTTCGACAGCCGGACGGAGCAGGGGCCTCAGGTGGATGAAACTCAGTTTAAGAAGATCCTCG
GC
TACATCAAATCGGGACAACAAGAAGGGGCGAAGCTGCTGTGTGGTGGGGGCGCTGCCGCGGACCGTGG
C
TACTTTATCCAGCCCACCGTGTTCGGGGACGTAAAAGACGGCATGACCATTGCCAAGGAGGAGATCTTT
GGA
CCAGTGATGCAAATCCTCAAATTCAAGACCATCGAGGAGGTTGTGGGGCGGGCCAATGATTCTAAGT
AT
GGGCTGGCAGCCGCCGTCTTCACAAAGGACCTGGATAAAGCCAATTACCTGTCCCAAGCTCTGCAGGC
T
GGCACTGTGTGGATCAACTGCTACGATGTGTTTGGGGCCCAGTCTCCATTTGGGGGCTATAAGATGTCA
GGG
AGTGGCAGGGAGCTGGGCGAGTATGGCCTGCAGGCGTACACAGAAGTGAAGACGGTTACTGTCAAAG
TG
CCACAGAAGAACTCGTAA


Translation (519 aa):
MLRAALTTVRRGPRLSRLLSAAATSAVPAPNHQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQV
A
EGNK
EDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVD
L
DMVLKCL
RYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVM
K
VAEQTPLTALYVANLIKE
AGFPPGVVNIVPGFGPTAGAAIASHEGVDKVAFTGSTEVGHLIQVAAGSSN
L
KRVTLELGGKSPNIIMSDAD
MDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYDEFVERSVARAKSRVV
G
NPFDSRTEQGPQ
VDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIF
G
PVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQALQAGTV
WINCYDVFGAQSPFGGYKMS
G
SGRELGEYGLQAYTEVKT
VTVKVPQKNS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser