NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19560.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19560.1 Public Mus musculus 5 Ung 23 108 98 CCDS HistoryNCBI Gene:22256Re-query CCDS DB by CCDS ID:19560.1Re-query CCDS DB by GeneID:22256See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19560.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000102584.10 ENSMUSP00000099644.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000102584.10Link to Ensembl Protein Viewer:ENSMUSP00000099644.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000102584Re-query CCDS DB by Protein ID:ENSMUSP00000099644
Original member Current member NCBI NM_011677.2 NP_035807.2 Accepted alive Link to Nucleotide Sequence:NM_011677.2Link to Protein Sequence:NP_035807.2Re-query CCDS DB by Nucleotide ID:NM_011677Re-query CCDS DB by Protein ID:NP_035807Link to BLAST:NP_035807.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035807.2 295 P97931-2 295 100% 0 0

Chromosomal Locations for CCDS 19560.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 114131229 114131513 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 114132181 114132276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 114135864 114135961 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 114136347 114136435 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 114137153 114137331 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 114138236 114138376 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (888 nt):
ATGGGCGTCTTGGGGCGGCGGTCTTTGCGGTTGGCGCGGAGAGCGGGGCTCCGGAGCCTGACTCCCAACC
CC
GACTCTGACTCCCGGCAGGCCAGCCCCGCCAAGAAGGCCCGGGTGGAGCAGAACGAGCAAGGCTCGCC
G
CTCAGCGCCGAGCAGCTCGTCCGCATCCAGAGGAACAAGGCCGCGGCGCTGCTCAGGCTCGCCGCCCGC
AAC
GTGCCTGCCGGCTTCGGCGAGAGCTGGAAGCAGCAGCTGTGCGGGGAGTTCGGGAAGCCGTACTTCG
TC
AAGCTAATGGGATTTGTTGCTGAAGAAAGGAACCACCACAAGGTCTATCCGCCCCCGGAGCAGGTGTT
C
ACATGGACCCAGATGTGCGACATCCGAGATGTGAAGGTTGTCATTCTGGGACAGGATCCCTATCACGGA
CCT
AATCAAGCTCACGGGCTCTGCTTCAGTGTCCAAAGACCAGTTCCACCCCCGCCCAGTTTGGAAAACA
TT
TTTAAAGAGCTGTCTACAGACATCGATGGTTTTGTTCATCCTGGCCATGGGGATTTGTCAGGGTGGGC
C
CGACAAGGTGTCCTCCTCCTCAACGCCGTCCTCACTGTCCGCGCCCACCAAGCCAATTCCCATAAGGAG
AGG
GGCTGGGAGCAGTTCACGGACGCGGTCGTGTCCTGGCTGAATCAGAACCTGAGTGGCCTCGTCTTCC
TC
CTCTGGGGCTCTTATGCTCAGAAGAAGGGCAGTGTCATTGACAGGAAGCGTCACCATGTCCTGCAGAC
A
GCTCACCCCTCCCCGCTGTCGGTGCACAGAGGGTTCCTGGGATGCAGACATTTTTCTAAAGCCAATGAA
CTG
CTCCAGAAGTCTGGCAAGAAGCCCATCAACTGGAAGGAGCTGTGA


Translation (295 aa):
MGVLGRRSLRLARRAGLRSLTPNPDSDSRQASPAKKARVEQNEQGSPLSAEQLVRIQRNKAAALLRLAAR
N
VPAGFGESWKQQLCGEFGKPYFVK
LMGFVAEERNHHKVYPPPEQVFTWTQMCDIRDVKVVILGQDPYHG
P
NQAHGLCFSVQRPVPPPP
SLENIFKELSTDIDGFVHPGHGDLSGWARQGVLLLNAVLTVRAHQANSHKE
R
GWEQFTDAVVSWLNQNLSGLVFLLWGSYAQKKGSVIDR
KRHHVLQTAHPSPLSVHRGFLGCRHFSKANE
L
LQKSGKKPINWKEL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser