NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19500.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19500.1 Public Mus musculus 5 Brdt 23 108 98 CCDS HistoryNCBI Gene:114642Re-query CCDS DB by CCDS ID:19500.1Re-query CCDS DB by GeneID:114642See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19500.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031215.14 ENSMUSP00000031215.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031215.14Link to Ensembl Protein Viewer:ENSMUSP00000031215.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000031215Re-query CCDS DB by Protein ID:ENSMUSP00000031215
Original member Current member NCBI NM_054054.2 NP_473395.2 Accepted alive Link to Nucleotide Sequence:NM_054054.2Link to Protein Sequence:NP_473395.2Re-query CCDS DB by Nucleotide ID:NM_054054Re-query CCDS DB by Protein ID:NP_473395Link to BLAST:NP_473395.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_473395.2 956 Q91Y44-1 956 100% 0 0

Chromosomal Locations for CCDS 19500.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 107342071 107342259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107343553 107343690 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107345136 107345250 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107348466 107348638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107350076 107350426 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107356752 107356880 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107357747 107357935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107358837 107359009 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107359193 107359473 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107359580 107359705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107359772 107359987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107369303 107369364 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107370155 107370329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107376265 107376362 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107377010 107377215 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107377904 107378084 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 107385458 107385526 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2871 nt):
ATGTCTCTGCCAAGTCGACAAACAGCTATTGTTAACCCCCCTCCACCAGAGTACATAAACACTAAGAAGA
GT
GGGCGGTTGACGAATCAGCTGCAGTTCCTACAGAGGGTTGTGCTGAAGGCCCTGTGGAAGCACGGCTT
C
TCTTGGCCTTTCCAACAGCCGGTGGACGCCGTGAAACTAAAGCTGCCTGACTATTACACCATCATAAAA
ACC
CCAATGGATTTAAATACAATTAAGAAGCGGTTGGAAAATAAGTATTATGAGAAGGCTTCCGAATGCA
TA
GAAGACTTCAACACAATGTTCTCAAACTGCTACTTATACAACAAGACTGGAGATGACATTGTTGTTAT
G
GCCCAAGCTCTAGAGAAGTTATTTATGCAGAAATTATCTCAGATGCCACAAGAAGAGCAAGTTGTGGGT
GGT
AAGGAGAGAATAAAGAAAGATATCCAACAAAAGATAGCGGTTTCCTCTGCTAAGGAACAAATCCCCT
CC
AAAGCGGCAGAGAATGTCTTTAAGCGGCAAGAGATTCCTTCTGGGCTTCCTGACATCTCTCTCTCGCC
C
TTAAACATGGCACAAGAAGCTCCCCCGATCTGTGACTCGCAGTCTCTGGTCCAAATTACAAAGGGTGTG
AAG
AGGCGAGCAGACACAACAACTCCTACCACTTCCATAGCTAAAGCAAGTAGCGAATCTCCTCCGACAC
TT
AGAGAAACAAAGCCAGTGAACATGCCAGTAAAAGAAAATACAGTAAAGAACGTTTTGCCAGACTCTCA
G
CAACAACACAAAGTTTTAAAAACAGTCAAAGTAACGGAGCAATTAAAGCACTGCAGCGAGATTCTTAAA
GAA
ATGCTTGCCAAGAAACATTTGCCGTATGCATGGCCCTTCTATAATCCTGTGGATGCTGATGCTTTGG
GA
CTCCACAACTACTATGACGTTGTCAAAAATCCCATGGATCTCGGAACGATCAAGGGGAAAATGGACAA
T
CAAGAATATAAGGATGCATATGAATTTGCTGCAGATGTCAGACTGATGTTCATGAACTGTTACAAGTAT
AAT
CCTCCCGATCATGAAGTTGTGGCGATGGCTCGGACCCTTCAGGATGTTTTTGAACTACATTTTGCCA
AG
ATTCCCGATGAACCTATTGAGAGTATGCATGCATGCCACCTTACAACAAACAGTGCACAAGCCCTCAG
C
AGAGAAAGCAGCAGCGAGGCCTCCTCGGGGGACGCCTCTTCTGAAGACTCTGAGGATGAACGAGTGCAG
CAT
CTTGCCAAGCTTCAGGAGCAGCTTAATGCTGTTCATCAGCAGCTGCAAGTTCTGTCCCAAGTTCCAT
TA
CGTAAGCTGAAGAAAAAGAATGAGAAGTCCAAAAGGGCGCCAAAAAGGAAAAAGGTTAATAACAGAGA
T
GAAAACCCAAGGAAAAAGCCTAAGCAAATGAAGCAAAAGGAGAAGGCCAAAATCAATCAACCAAAGAAG
AAG
AAGCCGCTTTTGAAATCGGAAGAGGAAGACAATGCGAAGCCTATGAACTACGATGAGAAAAGGCAGC
TG
AGCTTGGACATAAACAAACTGCCTGGAGACAAGCTTGGTCGAATAGTTCACATAATACAGTCAAGGGA
G
CCTTCCCTGAGAAACTCCAACCCGGACGAGATCGAGATCGACTTTGAGACCCTGAAGGCATCCACACTT
AGA
GAACTGGAGAAGTATGTCCTGGCCTGTCTGAGGAAGAGGTCGCTGAAGCCCCAAGCAAAGAAGGTTG
TC
AGGTCTAAGGAGGAGCTCCATTCTGAAAAAAAGCTGGAGCTGGAGAGGCGGTTGCTGGACGTCAACAA
T
CAGCTGAATTGTAGGAAACGGCAAACGAAACGTCCAGCAAAAGTGGAGAAGCCGCCCCCGCCCCCGCCC
CCG
CCCCCGCCCCCGCCGCCTCCCCCGGAGCTGGCCAGTGGGTCTCGCCTGACCGACAGCAGCAGCAGCA
GC
GGCAGCGGCAGCGGCAGCAGCAGCAGCAGCAGCGGCAGCAGCAGCAGCAGCAGCTCCTCGGGGTCCGC
G
AGCAGCAGCAGCGACTCGAGCTCCTCCGACAGCAGCGATTCTGAACCAGAAATATTTCCTAAATTTACT
GGA
GTAAAACAGAATGATTTACCTCCAAAAGAAAATATAAAGCAGATACAATCTTCTGTGCAAGACATAA
CC
TCTGCTGAAGCTCCCCTTGCTCAGCAGAGCACAGCACCATGCGGAGCCCCAGGGAAGCACTCCCAGCA
G
ATGCTTGGTTGCCAAGTGACACAGCATCTGCAGGCCACAGAGAACACTGCATCTGTGCAGACTCAGCCT
CTT
TCAGGTGATTGCAAGCGAGTATTGCTTGGCCCCCCTGTGGTGCACACCTCTGCTGAGAGCCTCACAG
TG
CTGGAGCCAGAATGCCATGCTCCCGCGCAGAAGGATATAAAGATTAAGAATGCAGACTCTTGGAAAAG
T
TTAGGGAAGCCAGTGAAAGCATCAAGTGTACTGAAGTCTTCAGATGAGCTTTTCAACCAGTTTAGAAAA
GCT
GCAATAGAAAAGGAGGTAAAGGCCCGGACACAGGAGCAGATGCGGAAACACCTGGAGCATAATGCGA
AG
GACCCAAAAGTATCTCAAGAAAATCAGAGGGAGCCTGGAAGTGGATTGACTCTAGAATCTTTATCAAG
T
AAAGTGCAAGATAAGTCTCTTGAAGAAGATCAGAGTGAACAGCAGCCACCGTCGGAAGCTCAAGACGTA
AGC
AAGCTCTGGCTTCTCAAAGACCGGAATCTAGCGAGGGAGAAAGAGCAAGAGCGCAGGAGAAGAGAAG
CA
ATGGCGGGTACCATTGATATGACTCTTCAAAGTGACATTATGACAATGTTTGAAAATAACTTTGATTA
A


Translation (956 aa):
MSLPSRQTAIVNPPPPEYINTKKSGRLTNQLQFLQRVVLKALWKHGFSWPFQQPVDAVKLKLPDYYTIIK
T
PMDLNTIKKRLENKYYEKASECIEDFNTMFSNCYLYNK
TGDDIVVMAQALEKLFMQKLSQMPQEEQVVG
G
KERIKK
DIQQKIAVSSAKEQIPSKAAENVFKRQEIPSGLPDISLSPLNMAQEAPPICDSQSLVQITKGV
K
RRADTTTPTTSIAKASSESPPTLRETKPVNMPVKENTVKNVLPDSQQQHKVLKTVKVTEQLKHCSEILK
E
MLAKKHLPYAWPFYNPVDADALGLHNYYDVVKNPMDLGTIK
GKMDNQEYKDAYEFAADVRLMFMNCYKY
N
PPDHEVVAMARTLQ
DVFELHFAKIPDEPIESMHACHLTTNSAQALSRESSSEASSGDASSEDSEDERVQ
H
LAKLQEQ
LNAVHQQLQVLSQVPLRKLKKKNEKSKRAPKRKKVNNRDENPRKKPKQMKQKEKAKINQPKK
K
KPLLKSEEEDNAKPMNYDEKRQLSLDINKLPGDKLGRIVHIIQSREPSLRNSNPDEIEIDFETLKASTL
R
ELEKYVLACLRKRSLKPQ
AKKVVRSKEELHSEKKLELERRLLDVNNQLNCRKRQTKRPAKVEKPPPPPP
P
PPPPPPPPELASGSRLTDSSSSSGSGSGSSSSSSGSSSSSSSSGSASSSSDSSSSDSSDSEP
EIFPKFT
G
VKQNDLPPKENIK
QIQSSVQDITSAEAPLAQQSTAPCGAPGKHSQQMLGCQVTQHLQATENTASVQTQP
L
S
GDCKRVLLGPPVVHTSAESLTVLEPECHAPAQKDIKIKNADSWKSLGKPVKASSVLKSSDELFNQFRK
A
AIEKEVKARTQEQMRKHLEHNAKDPKVSQENQ
REPGSGLTLESLSSKVQDKSLEEDQSEQQPPSEAQDV
S
KLWLLKDRNLAREKEQERRRREA
MAGTIDMTLQSDIMTMFENNFD



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser