NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, October 16, 2019, starting at 8:00 a.m. EDT for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19382.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19382.1 Public Mus musculus 5 Ugt2b1 21 106 86 CCDS HistoryNCBI Gene:71773Re-query CCDS DB by CCDS ID:19382.1Re-query CCDS DB by GeneID:71773See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 19382.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031183 ENSMUSP00000031183 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031183Link to Ensembl Protein Viewer:ENSMUSP00000031183Re-query CCDS DB by Nucleotide ID:ENSMUST00000031183Re-query CCDS DB by Protein ID:ENSMUSP00000031183
Original member Current member EBI,WTSI OTTMUST00000066215 OTTMUSP00000033149 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000066215Link to Vega Protein Viewer:OTTMUSP00000033149Re-query CCDS DB by Nucleotide ID:OTTMUST00000066215Re-query CCDS DB by Protein ID:OTTMUSP00000033149
Original member Current member NCBI NM_152811.1 NP_690024.1 Accepted alive Link to Nucleotide Sequence:NM_152811.1Link to Protein Sequence:NP_690024.1Re-query CCDS DB by Nucleotide ID:NM_152811Re-query CCDS DB by Protein ID:NP_690024Link to BLAST:NP_690024.1

Chromosomal Locations for CCDS 19382.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 86917589 86917865 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 86919250 86919469 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 86919605 86919692 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 86921876 86922007 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 86924548 86924696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 86925775 86926498 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1590 nt):
ATGTCTATGAAACAGGCTTCAGTTTTTCTGTTGATACAGTTCATATGCTATATTAGACCTGGAGCCTGTG
GG
AAAGTGCTGGTGTGGCCTACAGAATACAGCCATTGGATAAATATGAAAATAATCCTGGATGAACTTGT
C
CAGAGAGGTCATGACGTCACCGTTCTCATATCTTCTGCTTCCATCCTCATTGGGCCGAGCAATGAATCT
TCT
ATTAATTTTGAAATTTATTCTGCACCTTTGAGTAAAGATGATCTTGAATATGCTTTTGAAAAATGGG
TA
GGAAACTGGACATACGAATTAAAAAAACTTCCATTTTGGACATCTTATTCAAAACTGCAAAAAATCTC
C
AGTGAATATTCAGACATGATTGAAAGTTTCTGCAAAGCAGTAGTTTGGAACAAGAGCCTCATGAAAAAA
CTC
CAAGGATCTAAGTTTGATGTCGTTCTAGCAGATGCCTTGGTTCCCTGTGGTGAGCTGCTATCAGAAC
TG
CTTAAGACACCTTTAGTATACAGTCTCCGCTTCTGTCCTGGATACAAATGTGAAAAGTACAGTGGGGG
C
CTTCCACTCCCCCCTTCCTATGTGCCTGTGGTTCTGTCAGAACTAAGTGACCACATGACATTTGCAGAA
AGG
GTGAAGAATATGTTGCAGGTGTTGCTTTTTGACTTTTGGTTTCAAACATTTAACGAGAAATCCTGGA
AT
CAGTTTTACAGTGATGTTCTAGGGAGACCTACAACATTAACTGAGATGATGGGGAAGGCAGACATATG
G
CTCGTTCGAACCTTCTGGGACTTGAAATTTCCTCACCCTTTCTTGCCTAATTTTGACTTTGTTGGAGGA
CTC
CATTGTAAACCAGCCAAACCACTGCCTAAGGAAATGGAAGAATTTGTTCAGAGCTCTGGAGAACATG
GT
GTGGTGGTGTTTTCTCTGGGATCAATGGTTAAAAACATTAAAGAAGAAAAGGCCAATGTAGTTGCTTC
T
GCTCTTGCCCAGATTCCACAGAAGGTTCTGTGGAGATTTGATGGTAAGAAACCAGACACCTTAGGATCC
AAC
ACTCGGCTCTACAAGTGGATCCCCCAGAATGACCTTCTTGGTCATCCAAAAACCAAAGCTTTTATAG
CT
CATGGTGGAACCAATGGCATCTATGAGGCGATCTACCATGGCATTCCTATTGTTGGTATTCCCTTGTT
T
GGGGATCAACCTGATAATATTAACCACATAGTAGCCAAGGGAGCAGCTGTTAGAGTGGACTTTGATACA
ATG
TCAACTACAGACCTTCTCACTGCCTTGAAGACTGTCATTAATGACCCTTCCTATAAAGAGAATGCCA
TG
AGATTATCCAGAATCCACCATGACCAGCCAATGAAGCCCTTGGACCGAGCTGTCTTCTGGATCGAGTA
T
GTCATGCGCAACAAGGGAGCCAAGCACCTTCGCCCAGCTCTGCATGACCTTACCTGGTTCCAGTACCAC
TCT
CTGGATGTGATTGGGTTCCTATTGGTCTGTGTGGTAGCTGTGGTATTCATCATTGCAAAATGTTGCC
TC
TTTTGTTGCCATAAGACTGCTAACATGGGAAAGAAGAAAAAAGAGTAG


Translation (529 aa):
MSMKQASVFLLIQFICYIRPGACGKVLVWPTEYSHWINMKIILDELVQRGHDVTVLISSASILIGPSNES
S
INFEIYSAPLSKDDLEYAFEKWVGNWTYELKKLPFWTSYSKLQKISSEYSDMIESFCKAVVWNKSLMKK
L
QGSKFDVVLADALVPCGELLSELLKTPLVYSLRFCPGYKCEKYSGGLPLPPSYVPVVLSELSDHMTFAE
R
VKNMLQVLLFDFWFQTFNEKSWNQFYSDVL
GRPTTLTEMMGKADIWLVRTFWDLKFPHPFLPNFDFVGG
L
HCKPAKPLPK
EMEEFVQSSGEHGVVVFSLGSMVKNIKEEKANVVASALAQIPQKVLWRFDGKKPDTLGS
N
TRLYKWIPQNDLL
GHPKTKAFIAHGGTNGIYEAIYHGIPIVGIPLFGDQPDNINHIVAKGAAVRVDFDT
M
STTDLLTALKTVINDP
SYKENAMRLSRIHHDQPMKPLDRAVFWIEYVMRNKGAKHLRPALHDLTWFQYH
S
LDVIGFLLVCVVAVVFIIAKCCLFCCHKTANMGKKKKE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser