NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19167.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19167.1 Public Mus musculus 5 Emilin1 23 108 98 CCDS HistoryNCBI Gene:100952Re-query CCDS DB by CCDS ID:19167.1Re-query CCDS DB by GeneID:100952See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 19167.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031055.7 ENSMUSP00000031055.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031055.7Link to Ensembl Protein Viewer:ENSMUSP00000031055.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000031055Re-query CCDS DB by Protein ID:ENSMUSP00000031055
Original member Current member NCBI NM_133918.2 NP_598679.1 Accepted alive Link to Nucleotide Sequence:NM_133918.2Link to Protein Sequence:NP_598679.1Re-query CCDS DB by Nucleotide ID:NM_133918Re-query CCDS DB by Protein ID:NP_598679Link to BLAST:NP_598679.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_598679.1 1017 Q99K41 1017 100% 0 0

Chromosomal Locations for CCDS 19167.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 30913875 30914044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 30914982 30915107 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 30915517 30915737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 30916934 30918859 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 30919256 30919372 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 30919931 30919948 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 30920080 30920217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 30920615 30920952 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3054 nt):
ATGGCCCCCAGAGCCCTCTGGAGCTGCTATCTCTGCTGTCTGCTGACCATAGCCACGGAAGCTGCCAGCT
AC
CCTCCTCGAGGTTACAGCCTCTACACAGGAGGCACTGGGGCCCTGAGTCCTGGGGGACCCCAGGCCCA
G
AACTCACCACGGCCTGCCAGCCGCCACAGGAACTGGTGTGCCTACGTGGTGACTCGGACAGTGAGCTGC
GTC
CTTGAGGATGGAGTGGAGACCATTGTCAAGCCAGACTATCAACCCTGTGGCTGGGGCCAGCCCCACT
GT
TCCCGAAGTATCATGTACCGGAGCTTTCTTCGCCCTCGCTATCGGGTGGCTTACAAGACAGTGACAGA
C
ATGGAGTGGAGGTGCTGTCAGGGTTATGGGGGCGATGACTGTGGAGAGGGCCCTGCTTCCGTTCTGGGC
CCA
GCACCCTCCACACCACTTCCCCGGCCCAGGCCTGTGCGCCCCAACCTGTCTGGCTCCAGTGCCGGCA
GC
CATCTCAGTGGACTGGGAGGAGAAGGTCCTGTTGAGTCAGAGAAGGTGCAGCAGCTAGAGCGGCAGGT
G
AAGAGTCTGACCAAAGAGCTGCAAGGCCTTCGGGGTGTCCTGCAGGGGATGAATGGGCGCCTAGCAGAA
GAT
GTACAGCGAGCTGTGGACACAGTCTTTAATGGAAGGCAGCAGCCAGCAGATGCAGCTGCCCGCCCGG
GC
GTGCATGAAACCCTCAGTGAGATCCAGCAGCAGCTGCAGCTCCTGGACAACCGTGTCTCCACTCATGA
C
CAGGAGCTGGGCCACCTTAACAACCATCATAATGGAGGCCCTGGTGGAGGTGGCAGGGCCTCAGGCCCT
GTC
CCAGTTCCTTCTGGCCCCAGTGAAGAACTGTTAAGGCAGCTGGAACGGCAGCTGCAAGAGTCTTGCT
CA
GTGTGCCTGACGGGGCTGGATGGCTTCCGCCAGCAGCAGCAAGAGGATAGGGAGCGGCTGCGAACCCT
G
GAGAAGCTAATGTCCTCTATGGAGGAGCGGCAGCAACAGCTTGTGGGACCTGCCATGGCCAGGAGACCC
CCT
CAGGAATGCTGCCCCCCAGAGCTGGGTCGACGAGTGTCTGAGCTGGAGCGGAGGCTAGATGTAGTGA
CT
GGCTCACTGACAGTGCTAAGTGGACGCAGAGGTTCTGAGCTTGGAGGAGCAGCTGGGCAGGGGGGCCA
C
CCTCCAGGCTACACCAGCTTGGCCTCCCGCCTTTCTCGCCTGGAGGACCGCTTCAACTCTACCCTAGGT
CCC
TCAGAGGAGCAAGAGAAGAACTGGCCTGGAGGACCAGGGAGGCTGGGCCACTGGTTGCCTGCTGCTC
CA
GGACGGCTAGAAAAGCTGGAGGGACTACTAGCCAATGTGAGCAGGGAGCTGGGTGGCCGCATGGATCT
G
CTGGAAGAGCAGGTGGCAGGGGCTGTTCGGACTTGTGGGCAGATTTGCTCTGGGGCACCCGGGGAACAG
GAT
TCTCGGGTCAATGAGATCCTCAGTGCCTTGGAACGCAGGGTGCTGGACAGCGAGGGCCGGTTACAGC
TA
GTGGGCTCTGGCTTGCATGAAGCAGAGGCAGCAGGGGAGGCTCAGCAGGCCGTGTTGGAGGGACTGCA
A
GGGCTCCTGAGCCGGCTTCGGGAGCGCATGGATGCACAGGAGGAGACTGCAGCAGAAATCTTACTGCGC
CTC
AATCTTACCGCAGCCCAGCTAAGCCAGCTGGAGGGTCTGCTGCAAGCCCGTGGGGATGAGGGTTGTG
GC
GCCTGTGGTGGTGTCCAGGAGGAGCTGGGCCGCCTTCGGGATGGTGTGGAACGTTGCTCCTGCCCATT
G
TTACCTCCACGGGGCCCTGGAGCTGGCCCAGGGGTTGGGGGACCAAGCCGTGGGCCTCTGGATGGTTTC
AGT
GTGTTTGGGGGCAGTTCAGGCTCAGCCCTCCAGGCCCTTCAAGGAGAACTCTCTGAGGTTATTCTCA
CC
TTCAGCTCCCTGAACGACTCACTCCACGAGCTCCAGACCACTGTGGAGGGTCAGGGTGCCGATCTGGC
T
GACCTGGGGGCCACCAAGGACAGCATCATCTCTGAAATCAACAGACTACAGCAGGAGGCCACGGAGCAC
GTC
ACAGAGAGCGAGGAGCGCTTCCGAGGCCTGGAGGAGGGCCAGGCACAGGCTGGCCAATGCCCTAGCT
TA
GAGGGGCGATTAGGCCGCCTTGAGGGAGTCTGCGAACGACTGGACACCGTGGCAGGGGGACTACAAGG
C
CTACGTGAAGGCCTCTCCAGACACGTGGCTGGGCTCTGGGCTGCAGTACGGGAAAGCAACAGCACCAGC
CTG
ACACAGGCCGCCCTGCTGGAGAAGCTGCTGGGGGGCCAGGCAGGCCTGGGCAGGCGGCTTGGTGCCC
TC
AACAATTCCCTGCTGCTCCTGGAAGACCGTCTGCAGCAACTTAGCCTAAAGGACTTCACTGGACCTTC
A
GGCAAGGCTGGGCCCCCAGGGCCTCCCGGGCTACAAGGGCCTTCAGGCCCTGCAGGACCTCCAGGACCT
CCT
GGCAAAGACGGACAACAGGGGGCCATTGGCCCACCAGGTCCTCAAGGGGAGCAGGGAGCGGAGGGAG
CA
CCAGCAGCCCCTGTGCCTAGGGTAGCATTTTCAGCTGCCCTGAGTTTGCCACGGTCAGAACCTGGCAC
A
GTCCCCTTCGACAGAGTCTTGCTCAATGATGGAGGCTACTATGACCCAGAGACAGGTGTATTCACTGCA
CCA
CTGGCTGGACGCTATTTGCTGAGCGCTGTACTTACTGGGCACCGGCATGAGAAAGTGGAAGCAGTAT
TG
TCACGCTCCAACCTGGGCGTGGCCCGCATAGACTCGGGAGGCTATGAACCCGAGGGACTGGAGAATAA
G
CCTGTGGCCGAAAGTCAGCCCAGCCCAGGCGCTCTGGGCGTCTTCAGCCTCATTCTGCCACTGCAGGTC
GGA
GACACTGTCTGCATCGACCTGGTCATGGGGCAGCTGGCACACTCCGAGGAGCCGCTCACCATCTTCA
GC
GGAGCCCTGCTCTACGAGGACACAGAGCTTGAACAGGTGTAG


Translation (1017 aa):
MAPRALWSCYLCCLLTIATEAASYPPRGYSLYTGGTGALSPGGPQAQNSPRPASRHRNWCAYVVTRTVSC
V
LEDGVETIVKPDYQPCGWGQPHCSRSI
MYRSFLRPRYRVAYKTVTDMEWRCCQGYGGDDCGEGPASVLG
P
APSTPLPRPRPVRPNLSGSSAGSHLSGLGGE
GPVESEKVQQLERQVKSLTKELQGLRGVLQGMNGRLAE
D
VQRAVDTVFNGRQQPADAAARPGVHETLSEIQQQLQLLDNRVSTHDQELGHLNNHHNGGPGGGGRASGP
V
PVPSGPSEELLRQLERQLQESCSVCLTGLDGFRQQQQEDRERLRTLEKLMSSMEERQQQLVGPAMARRP
P
QECCPPELGRRVSELERRLDVVTGSLTVLSGRRGSELGGAAGQGGHPPGYTSLASRLSRLEDRFNSTLG
P
SEEQEKNWPGGPGRLGHWLPAAPGRLEKLEGLLANVSRELGGRMDLLEEQVAGAVRTCGQICSGAPGEQ
D
SRVNEILSALERRVLDSEGRLQLVGSGLHEAEAAGEAQQAVLEGLQGLLSRLRERMDAQEETAAEILLR
L
NLTAAQLSQLEGLLQARGDEGCGACGGVQEELGRLRDGVERCSCPLLPPRGPGAGPGVGGPSRGPLDGF
S
VFGGSSGSALQALQGELSEVILTFSSLNDSLHELQTTVEGQGADLADLGATKDSIISEINRLQQEATEH
V
TESEERFRGLEEGQAQAGQCPSLEGRLGRLEGVCERLDTVAGGLQGLREGLSRHVAGLWAAVRESNSTS
L
TQAALLEKLLGGQAGLGRRLGALNNSLLLLEDRLQQLSLKDFT
GPSGKAGPPGPPGLQGPSGPAGPPGP
P
GKDGQQGAIGPP
GPQGEQGAEGAPAAPVPRVAFSAALSLPRSEPGTVPFDRVLLNDGGYYDPETGVFTA
P
LAGRYLLSAVLTGHRHEKVEAVLSRSNLGVARIDSGGYEPEGLENKPVAESQPSPGALGVFSLILPLQV
G
DTVCIDLVMGQLAHSEEPLTIFSGALLYEDTELEQV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser