NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19114.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19114.1 Public Mus musculus 5 Klhl7 23 108 98 CCDS HistoryNCBI Gene:52323Re-query CCDS DB by CCDS ID:19114.1Re-query CCDS DB by GeneID:52323See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19114.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000030841.9 ENSMUSP00000030841.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000030841.9Link to Ensembl Protein Viewer:ENSMUSP00000030841.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000030841Re-query CCDS DB by Protein ID:ENSMUSP00000030841
Original member Current member NCBI NM_026448.3 NP_080724.2 Accepted alive Link to Nucleotide Sequence:NM_026448.3Link to Protein Sequence:NP_080724.2Re-query CCDS DB by Nucleotide ID:NM_026448Re-query CCDS DB by Protein ID:NP_080724Link to BLAST:NP_080724.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080724.2 586 Q8BUL5 586 100% 0 0

Chromosomal Locations for CCDS 19114.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 24100755 24100874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 24126822 24126924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 24127669 24127762 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 24127980 24128104 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 24134964 24135139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 24138306 24138480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 24141151 24141293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 24149125 24149365 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 24156890 24157091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 24158539 24158636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 24159447 24159730 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1761 nt):
ATGGCCACCTCCGGCGTGGAAAAGAGTAGCAAGAAGAAAACTGAGAAGAAACTTGCGGCTCGCGAAGAAG
CC
AAGCTGCTGGCGGGGTTCATGGGCGTCATGAACAACATGAGGAAACAGAGAACACTGTGTGACGTGAT
C
CTCACTGTCCAGGAAAGAAAGATCCCCGCTCACCGCGTTGTCCTGGCTGCAGCCAGTCACTTCTTTAAC
TTA
ATGTTCACAACTAACATGCTTGAATCTAAGTCCTTTGAAGTAGAACTCAAAGATGCTGAACCTGATA
TT
ATTGAACAACTGGTGGAATTTGCTTATACTGCTAGAATTTCTGTGAATAGCAACAATGTTCAGTCTTT
G
TTAGATGCAGCAAATCAGTACCAGATTGAACCTGTGAAGAAAATGTGTGTTGATTTTTTGAAAGAACAA
GTT
GATGCTTCAAATTGTCTTGGTATAAGTGTGCTTGCAGAGTGTCTGGACTGTCCTGAACTGAAAGCTA
CA
GCTGATGACTTCATTCATCAGCATTTCACTGAGGTTTACAAAACAGATGAATTCCTGCAGCTTGATGT
C
AAGCGAGTGACACATCTTCTCAGCCAGGACACCCTGACTGTGAGAGCAGAGGACCAGGTTTATGACGCT
GCC
GTGAGGTGGTTGAAATATGATGAGCCTAACCGCCAGCCATTCATGGTTGATATCCTTGCTAAAGTCA
GG
TTTCCTCTTATATCGAAGAATTTCCTAAGTAAAACAGTACAAGCTGAACCACTTATTCAAGATAATCC
T
GAATGCCTTAAAATGGTGATAAGTGGAATGAGGTACCATCTGCTGTCTCCTGAGGATCGAGAAGAACTT
GCA
GGTGGCACACGGCCTAGAAGAAAGAAACATGATTACCGCATAGCTCTGTTTGGAGGCTCCCAACCAC
AG
TCCTGTAGATATTTTAACCCAAAGGATTACAGTTGGACAGACATTCGCTGCCCCTTTGAAAAACGAAG
A
GATGCAGCATGTGTGTTTTGGGACAATGTAGTATACATTTTGGGAGGTTCTCAGCTTTTCCCCATAAAG
CGA
ATGGATTGCTACAATGTTGTAAAGGATAGCTGGTATTCCAAACTGGGCCCTCCAACACCTCGAGACA
GC
CTTGCTGCCTGTGCAGCAGAAGGCAAAATTTATACATCTGGAGGTTCAGAAGTAGGAAACTCGGCCCT
G
TATTTGTTTGAATGCTATGATACAAGGACCGAGAGTTGGCACACGAAGCCCAGCATGCTGACTCAGCGC
TGC
AGCCATGGGATGGTGGAGGCCAATGGCCTCATCTATGTTTGTGGTGGAAGCTTAGGAAACAATGTTT
CT
GGGAGAGTGCTTAGTTCCTGTGAAGTGTATGATCCTGCCACAGAAACATGGACTGAGCTGTGTTCAAT
G
ATTGAGCCCAGGAAGAATCATGGGCTGGTGTTTGTGAAGGACAAGATATTTGCTGTCGGTGGTCAGAAT
GGT
TTAGGTGGTCTGGACAATGTGGAATATTACGATATCAAGTTAAATGAATGGAAGATGGTGTCACCGA
TG
CCATGGAGGGGTGTCACGGTGAAGTGTGCAGCAGTTGGCTCTGTCATCTATGTCCTGGCAGGTTTTCA
G
GGTGTAGGCAGATTGGGGCATATCCTTGAGTATAATACTGAAACAGATAAGTGGATCGCCAACTCAAAA
GTC
CGGGCTTTCCCAGTCACAAGTTGTCTAATTTGTGTTGTTGATACTTGTGGAGCAAATGAAGAGACCC
TT
GAAACATGA


Translation (586 aa):
MATSGVEKSSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQRTLCDVILTVQERKIPAHRVVLAAASHFFN
L
MFT
TNMLESKSFEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDAANQYQIEPVKKMCVDFLKEQ
V
DASNCL
GISVLAECLDCPELKATADDFIHQHFTEVYKTDEFLQLDVKRVTHLLSQDTLTVRAEDQVYDA
A
VRWLKYDEPNRQPFMVDILAKVRFPLISKNFLSKTVQAEPLIQDNPECLKMVI
SGMRYHLLSPEDREEL
A
GGTRPRRKKHDYRIALFGGSQPQSCRYFNPK
DYSWTDIRCPFEKRRDAACVFWDNVVYILGGSQLFPIK
R
MDCYNVVKDSWYSKLGPPTPRDSLAACAAEGKIYTSGGSEV
GNSALYLFECYDTRTESWHTKPSMLTQR
C
SHGMVEANGLIYVCGGSLGNNVSGRVLSSCEVYDPATE
TWTELCSMIEPRKNHGLVFVKDKIFAVGGQN
G
L
GGLDNVEYYDIKLNEWKMVSPMPWRGVTVKCAAVGSVIYVLAGFQGVGRLGHILEYNTETDKWIANSK
V
RAFPVTSCLICVVDTCGANEETLET




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser