NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19088.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19088.1 Public Mus musculus 5 Dmtf1 23 108 98 CCDS HistoryNCBI Gene:23857Re-query CCDS DB by CCDS ID:19088.1Re-query CCDS DB by GeneID:23857See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19088.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000071921.12 ENSMUSP00000071815.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000071921.12Link to Ensembl Protein Viewer:ENSMUSP00000071815.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000071921Re-query CCDS DB by Protein ID:ENSMUSP00000071815
Original member Current member NCBI NM_011806.3 NP_035936.3 Accepted alive Link to Nucleotide Sequence:NM_011806.3Link to Protein Sequence:NP_035936.3Re-query CCDS DB by Nucleotide ID:NM_011806Re-query CCDS DB by Protein ID:NP_035936Link to BLAST:NP_035936.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035936.3 761 Q8CE22-1 761 100% 0 0

Chromosomal Locations for CCDS 19088.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 9120029 9120138 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9120350 9120494 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9121085 9121462 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9121782 9121937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9124442 9124527 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9126540 9126749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9127957 9128108 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9129148 9129376 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9130368 9130477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9131276 9131308 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9132456 9132613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9136066 9136142 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9137126 9137240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9140386 9140480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9148900 9149022 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9150376 9150484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2286 nt):
ATGAGCACAGTTGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACGTTTACTCAGG
AC
ACGGACGGGAATCTCATTCTTCATTGCCCTCAGAATGACCCTGATGAAGTAGACTCAGAAGACAGTAC
T
GAACCTCCACATAAGAGGCTTTGTTTGTCCTCTGAGGATGATCAAAGCATTGATGACGCTACGCCATGC
ATA
TCAGTCGTGGCACTCCCACTTTCAGAAAATGATCAGAGCTTTGAGGTGACCATGACGGCAACTACAG
AG
GTGGCAGATGATGAACTTTCTGAGGGAACTGTGACACAAATTCAGATTTTACAGAATGATCAACTAGA
T
GAAATATCTCCATTGGGTACTGAGGAAGTCTCAGCAGTTAGCCAAGCGTGGTTTACAACTAAAGAAGAT
AAG
GATTCTCTCACTAACAAAGGACATAAATGGAAGCAGGGGATGTGGTCCAAGGAAGAAATTGATATTT
TA
ATGAACAACATCGAGCGCTATCTGAAGGCTCGCGGAATAAAAGATGCTACAGAAATCATCTTTGAGAT
G
TCAAAAGACGAAAGAAAAGATTTCTACAGGACTATAGCGTGGGGGCTGAACCGGCCTTTGTTTGCAGTT
TAT
AGAAGAGTGCTGCGCATGTATGATGACAGGAACCATGTGGGAAAATACACTCCTGAAGAGATCGAGA
AG
CTCAAGGAGCTCCGGATAAAACACGGCAATGACTGGGCAACAATAGGGGCGGCCCTAGGAAGAAGTGC
C
TCTTCTGTCAAAGACCGCTGCCGGCTGATGAAGGATACCTGCAACACAGGGAAATGGACAGAAGAAGAA
GAA
AAGAGACTTGCAGAGGTAGTTCATGAATTAACAAGCACGGAGCCAGGTGACATCGTCACACAGGGTG
TG
TCTTGGGCAGCTGTAGCTGAAAGAGTGGGTACCCGCTCAGAAAAGCAATGCCGTTCTAAATGGCTCAA
C
TACCTGAACTGGAAGCAGAGTGGGGGTACTGAATGGACCAAGGAAGATGAAATCAATCTCATCCTAAGG
ATA
GCTGAGCTTGATGTGGCCGATGAAAATGACATAAACTGGGATCTTTTAGCTGAAGGATGGAGCAGTG
TC
CGTTCACCACAGTGGCTTCGAAGTAAATGGTGGACCATCAAAAGGCAAATTGCAAACCATAAGGATGT
T
TCATTTCCTGTCCTAATAAAAGGTCTTAAACAGTTACATGAGAACCAAAAAAACAACCCAGTGCTTTTG
GAG
AATAAATCAGGATCTGGAGTTCCAAACAGTAATTGCAATTCCAGTGTACAGCATGTTCAGATCAGAG
TC
GCCCGCTTGGAAGATAATACAGCCATCTCTCCAAGCCCCATGGCAGCGTTGCAGATTCCAGTCCAGAT
C
ACCCACGTCTCTTCAACAGACTCCCCTGCTGCTTCTGTTGACTCAGAAACAATCACACTAAACAGTGGA
ACA
CTACAAACATTTGAGATTCTTCCATCTTTCCATTTACAGCCCACTGGTACTCCAGGCACCTACCTTC
TT
CAAACAAGCTCAAGTCAAGGCCTTCCCCTAACACTGACCACAAATCCCACAGTAACCCTGGCAGCTGC
T
GCTCCTGCTTCTCCTGAACAGATCATTGTTCATGCTTTATCCCCAGAACATTTGTTGAACACAAGCGAT
AAT
GTCACGGTACAATGTCACACACCAAGAGTCATCATTCAGACGGTAGCTACAGAGGACATCACTTCTT
CA
TTATCCCAAGAGGAACTGACAGTTGATAGTGATCTTCATTCATCTGATTTCCCTGAGCCTCCAGATGC
A
CTAGAAGCAGACACTTTCCCAGACGAAATTCCTCGGCCTAAGATGACTATACAACCATCATTTAATAAT
GCT
CATGTATCTAAATTCAGCGACCAAAATAGCACAGAACTGATGAACAGTGTCATGGTCAGAACAGAGG
AA
GAAATTGCCGACACTGACCTTAAGCAGGAAGAACCGCCGTCTGACTTAGCCAGTGCTTATGTTACTGA
G
GATTTAGAGTCTCCCACCATAGTGCACCAAGTTCATCAGACAATTGATGATGAAACAATACTTATCGTT
CCT
TCACCTCATGGCTTTATCCAGGCATCTGATGTTATAGATACTGAATCTGTCTTGCCTTTGACAACAC
TA
ACAGATCCAATATTCCAGCATCATCAGGAAGCATCAAATATAATTGGATCATCTTTGGGCAGTCCTGT
T
TCTGAAGACTCAAAGGATGTTGAGGACTTAGTAAACTGTCACTAG


Translation (761 aa):
MSTVEEDSDTVTVETVNSVTFTQDTDGNLILHCPQNDPDEVDSEDSTEPPHKRLCLSSEDDQSIDDATPC
I
SVVALP
LSENDQSFEVTMTATTEVADDELSEGTVTQIQILQNDQLDEISPLGTEEVSAVSQAWFTTKED
K
DSLTNK
GHKWKQGMWSKEEIDILMNNIERYLKARGIKDATEIIFEMSKDERKDFYRTIAWGLNRPLFAV
Y
RRVLRMYDDRNHVG
KYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNTGKWTEEE
E
KRLAEVVHELTSTEPGDIVTQGVSWAAVAERVGTRSEKQCRSKWLNYLNWKQSGGTEWTKEDEINLIL
R
I
AELDVADENDINWDLLAEGWSSVRSPQWLRSKWWTIKRQIANHKDVSFP
VLIKGLKQLHENQKNNPVLL
E
NKSGSGVPNSNCNSSVQHVQIRVARLEDNTAISPSPMAALQIPVQITHV
SSTDSPAASVDSETITLNSG
T
LQTFEILP
SFHLQPTGTPGTYLLQTSSSQGLPLTLTTNPTVTLAAAAPASPEQIIVHALSPEHLLNTSD
N
VTVQCHTPRVIIQTVATEDITSSLSQEELTVDSDLHSSDFPEPPDALEADTFPDEIPRPKMTIQPSFNN
A
HVSKFSDQNSTELMNSVMVRTEEEIADTDLKQEEPPSDLASAYVTE
DLESPTIVHQVHQTIDDETILIV
P
SPHGFIQASDVIDTESVLPLTTLT
DPIFQHHQEASNIIGSSLGSPVSEDSKDVEDLVNCH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser