NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS19041.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19041.1 Public Mus musculus 4 Mrpl20 23 108 98 CCDS HistoryNCBI Gene:66448Re-query CCDS DB by CCDS ID:19041.1Re-query CCDS DB by GeneID:66448See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19041.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000030942.12 ENSMUSP00000030942.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000030942.12Link to Ensembl Protein Viewer:ENSMUSP00000030942.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000030942Re-query CCDS DB by Protein ID:ENSMUSP00000030942
Original member Current member EBI ENSMUST00000137487.8 ENSMUSP00000139122.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000137487.8Link to Ensembl Protein Viewer:ENSMUSP00000139122.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000137487Re-query CCDS DB by Protein ID:ENSMUSP00000139122
Original member Current member NCBI NM_025570.3 NP_079846.1 Accepted alive Link to Nucleotide Sequence:NM_025570.3Link to Protein Sequence:NP_079846.1Re-query CCDS DB by Nucleotide ID:NM_025570Re-query CCDS DB by Protein ID:NP_079846Link to BLAST:NP_079846.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079846.1 149 Q9CQL4 149 100% 0 0

Chromosomal Locations for CCDS 19041.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 155803656 155803742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155803833 155803943 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155806908 155806985 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155808479 155808652 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (450 nt):
ATGGTCTTCCTCACGACGCGGCTCTGGCTGCGGAACCGCCTCACCGATCGCTATTGGCGGGTTCAGGAGG
TG
CTGAAACACGCTCAGCATTTTCGGGGAAGGAAGAATCGCTGCTACCGCCTGGCCGTCAGGGCGGTGAC
C
AGAGCCTTCGTTAAGTGTACGAAGGCCCGCAGACTTAAGAAGCGGAACCTGAGGACCCTCTGGATTAAT
CGA
ATTACAGCTGCCTCCCAGGAACATGGCTTAAAGTACCCAGCATTCATTGTCAACTTAATTAAGTGCC
AG
GTGGAGCTCAACAGGAAAGTTCTTGTGGACCTGGCCATCTATGAACCAAAGACGTTTAAATCTTTGGC
T
GCATTGGCTAAGCGGAGGCAGCAGGAGGGATTTGCTGCAGCTTTGGGGGATGGAAAGGAGCCTGAAGGT
ATC
TTTTCCAGAGTGGTGCAGTACCACTGA


Translation (149 aa):
MVFLTTRLWLRNRLTDRYWRVQEVLKHAQHFRGRKNRCYRLAVRAVTRAFVKCTKARRLKKRNLRTLWIN
R
ITAASQEHGLKYPAFIVNLIK
CQVELNRKVLVDLAIYEPKTFKSLAALAKRRQQEGFAAALGDGKEPEG
I
FSRVVQYH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser