NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19022.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19022.1 Public Mus musculus 4 Rer1 23 108 98 CCDS HistoryNCBI Gene:67830Re-query CCDS DB by CCDS ID:19022.1Re-query CCDS DB by GeneID:67830See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19022.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000030914.3 ENSMUSP00000030914.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000030914.3Link to Ensembl Protein Viewer:ENSMUSP00000030914.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000030914Re-query CCDS DB by Protein ID:ENSMUSP00000030914
Original member Current member NCBI NM_001362981.1 NP_001349910.1 Accepted alive Link to Nucleotide Sequence:NM_001362981.1Link to Protein Sequence:NP_001349910.1Re-query CCDS DB by Nucleotide ID:NM_001362981Re-query CCDS DB by Protein ID:NP_001349910Link to BLAST:NP_001349910.1
Original member Current member NCBI NM_026395.2 NP_080671.1 Accepted alive Link to Nucleotide Sequence:NM_026395.2Link to Protein Sequence:NP_080671.1Re-query CCDS DB by Nucleotide ID:NM_026395Re-query CCDS DB by Protein ID:NP_080671Link to BLAST:NP_080671.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001349910.1 196 Q9CQU3 196 100% 0 0
NP_080671.1 196 Q9CQU3 196 100% 0 0

Chromosomal Locations for CCDS 19022.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 155074939 155075028 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155075589 155075724 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155076712 155076790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155078494 155078593 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155080799 155080903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155082667 155082747 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (591 nt):
ATGTCTGAAGGGGACAGTGTTGGAGACTCTGTCCATGGGAAGCCCTCGGTGGTGTACAGATTTTTCTCAC
GG
CTTGGACAGATTTATCAGTCCTGGCTGGACAAGTCTACCCCCTACACAGCCGTCCGGTGGGTTGTGAC
A
CTGGGCCTGAGTTTTGTCTACATGATTAGAGTTTACCTGTTACAAGGTTGGTACATTGTGACCTACGCC
TTG
GGAATTTACCACCTAAACCTTTTCATTGCGTTCCTTTCTCCCAAAGTGGATCCTTCCTTGATGGAAG
AC
TCAGATGACGGCCCTTCATTACCAACCAAACAGAATGAGGAATTTCGTCCCTTCATTCGAAGGCTTCC
A
GAATTCAAATTTTGGCACGCAGCTACAAAAGGCATTCTTGTGGCTATGATCTGTACCTTCTTCGAGGCT
TTT
AACGTCCCAGTGTTCTGGCCGATCCTGGTGATGTACTTCATCATGCTTTTCTGTATCACAATGAAGA
GG
CAAATCAAGCACATGATTAAATACCGGTACATACCATTCACACACGGGAAGAGGAGATACAAAGGGAA
G
GAGGACGTGGGCAAGACATTTGCTAGTTAG


Translation (196 aa):
MSEGDSVGDSVHGKPSVVYRFFSRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYA
L
GIYHLNLFIAFLSPKVDPSLMEDS
DDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMICTFFEA
F
NVPVFWPILVMYFIMLFCITMKRQIK
HMIKYRYIPFTHGKRRYKGKEDVGKTFAS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser