NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS1860.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1860.1 Public Homo sapiens 2 FANCL 22 109 92 CCDS HistoryNCBI Gene:55120Re-query CCDS DB by CCDS ID:1860.1Re-query CCDS DB by GeneID:55120See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1860.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000233741.8 ENSP00000233741.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000233741.8Link to Ensembl Protein Viewer:ENSP00000233741.4Re-query CCDS DB by Nucleotide ID:ENST00000233741Re-query CCDS DB by Protein ID:ENSP00000233741
Original member NCBI NM_018062.3 NP_060532.2 Updated not alive Link to Nucleotide Sequence:NM_018062.3Link to Protein Sequence:NP_060532.2Re-query CCDS DB by Nucleotide ID:NM_018062Re-query CCDS DB by Protein ID:NP_060532
Current member NCBI NM_018062.4 NP_060532.2 Accepted alive Link to Nucleotide Sequence:NM_018062.4Link to Protein Sequence:NP_060532.2Re-query CCDS DB by Nucleotide ID:NM_018062Re-query CCDS DB by Protein ID:NP_060532Link to BLAST:NP_060532.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_060532.2 375 Q9NW38-1 375 100% 0 0

Chromosomal Locations for CCDS 1860.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 58159765 58159800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58160108 58160179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58161522 58161638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58162866 58162947 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58163029 58163074 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58163434 58163517 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58165724 58165874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58198594 58198662 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58204130 58204226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58221942 58222042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58226728 58226784 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58229814 58229874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58232054 58232112 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58241218 58241313 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1128 nt):
ATGGCGGTGACGGAAGCGAGCCTGTTGCGCCAGTGCCCCCTGCTTCTGCCCCAGAACCGGTCGAAAACCG
TG
TATGAGGGATTCATCTCGGCTCAGGGAAGAGACTTCCACCTTAGGATAGTGTTGCCTGAAGATTTACA
A
CTGAAGAATGCAAGATTATTATGTAGTTGGCAGCTGAGAACAATACTTAGTGGATACCATCGAATAGTA
CAA
CAGAGAATGCAGCACTCTCCTGATCTAATGAGCTTTATGATGGAGTTGAAGATGCTTTTGGAAGTTG
CC
TTAAAGAATAGACAAGAGCTGTATGCACTACCTCCTCCTCCCCAGTTCTACTCAAGCCTTATTGAAGA
G
ATAGGAACTCTTGGTTGGGATAAACTTGTGTATGCGGATACCTGCTTCAGTACCATCAAGTTAAAAGCA
GAA
GATGCTTCTGGTAGAGAGCATTTAATCACTCTCAAGTTGAAGGCAAAGTATCCTGCAGAATCACCAG
AT
TATTTTGTGGATTTTCCTGTTCCATTTTGTGCCTCCTGGACACCTCAGAGCTCCTTAATAAGCATTTA
T
AGTCAGTTTTTGGCAGCAATAGAATCACTAAAGGCATTCTGGGATGTTATGGATGAAATCGATGAGAAG
ACC
TGGGTACTTGAGCCAGAAAAACCTCCACGGAGTGCAACAGCACGCAGAATTGCATTAGGTAATAATG
TT
TCCATAAATATAGAGGTAGACCCCAGGCATCCTACTATGCTTCCTGAGTGCTTCTTTCTTGGAGCTGA
C
CATGTGGTAAAACCCCTGGGAATTAAGCTGAGCAGGAACATACATTTGTGGGATCCAGAAAATAGTGTG
TTA
CAAAATTTGAAAGATGTTTTAGAAATTGATTTTCCAGCTCGTGCTATCCTGGAAAAATCTGATTTTA
CT
ATGGATTGTGGAATTTGTTATGCTTATCAACTTGACGGTACCATTCCTGATCAAGTGTGTGATAATTC
T
CAGTGTGGACAACCTTTCCATCAAATATGCTTATATGAGTGGCTGAGAGGACTACTAACTAGTAGACAG
AGT
TTTAACATCATATTTGGTGAATGTCCATATTGTAGTAAGCCAATTACCTTAAAAATGTCTGGAAGGA
AA
CACTGA


Translation (375 aa):
MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIV
Q
Q
RMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKA
E
DASGREHLITLKLKAK
YPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEK
T
WVLEPEKPPRSATARRIAL
GNNVSINIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSV
L
QNLKDVLEIDFPARAILEKS
DFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQ
S
FNIIFGECPYCSK
PITLKMSGRKH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser