NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1843.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1843.1 Public Homo sapiens 2 FSHR 22 109 92 CCDS HistoryNCBI Gene:2492Re-query CCDS DB by CCDS ID:1843.1Re-query CCDS DB by GeneID:2492See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1843.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000406846.6 ENSP00000384708.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000406846.6Link to Ensembl Protein Viewer:ENSP00000384708.2Re-query CCDS DB by Nucleotide ID:ENST00000406846Re-query CCDS DB by Protein ID:ENSP00000384708
Original member Current member NCBI NM_000145.3 NP_000136.2 Accepted alive Link to Nucleotide Sequence:NM_000145.3Link to Protein Sequence:NP_000136.2Re-query CCDS DB by Nucleotide ID:NM_000145Re-query CCDS DB by Protein ID:NP_000136Link to BLAST:NP_000136.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000136.2 695 P23945-1 695 99.8561% 0 1

Chromosomal Locations for CCDS 1843.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 48962733 48963966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 48968698 48968883 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 48982912 48982986 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 48983098 48983166 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 48988977 48989054 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 48990566 48990637 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 49017489 49017563 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 49020086 49020160 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 49068219 49068290 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 49154266 49154417 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2088 nt):
ATGGCCCTGCTCCTGGTCTCTTTGCTGGCATTCCTGAGCTTGGGCTCAGGATGTCATCATCGGATCTGTC
AC
TGCTCTAACAGGGTTTTTCTCTGCCAAGAGAGCAAGGTGACAGAGATTCCTTCTGACCTCCCGAGGAA
T
GCCATTGAACTGAGGTTTGTCCTCACCAAGCTTCGAGTCATCCAAAAAGGTGCATTTTCAGGATTTGGG
GAC
CTGGAGAAAATAGAGATCTCTCAGAATGATGTCTTGGAGGTGATAGAGGCAGATGTGTTCTCCAACC
TT
CCCAAATTACATGAAATTAGAATTGAAAAGGCCAACAACCTGCTCTACATCAACCCTGAGGCCTTCCA
G
AACCTTCCCAACCTTCAATATCTGTTAATATCCAACACAGGTATTAAGCACCTTCCAGATGTTCACAAG
ATT
CATTCTCTCCAAAAAGTTTTACTTGACATTCAAGATAACATAAACATCCACACAATTGAAAGAAATT
CT
TTCGTGGGGCTGAGCTTTGAAAGTGTGATTCTATGGCTGAATAAGAATGGGATTCAAGAAATACACAA
C
TGTGCATTCAATGGAACCCAACTAGATGAGCTGAATCTAAGCGATAATAATAATTTAGAAGAATTGCCT
AAT
GATGTTTTCCACGGAGCCTCTGGACCAGTCATTCTAGATATTTCAAGAACAAGGATCCATTCCCTGC
CT
AGCTATGGCTTAGAAAATCTTAAGAAGCTGAGGGCCAGGTCGACTTACAACTTAAAAAAGCTGCCTAC
T
CTGGAAAAGCTTGTCGCCCTCATGGAAGCCAGCCTCACCTATCCCAGCCATTGCTGTGCCTTTGCAAAC
TGG
AGACGGCAAATCTCTGAGCTTCATCCAATTTGCAACAAATCTATTTTAAGGCAAGAAGTTGATTATA
TG
ACTCAGGCTAGGGGTCAGAGATCCTCTCTGGCAGAAGACAATGAGTCCAGCTACAGCAGAGGATTTGA
C
ATGACGTACACTGAGTTTGACTATGACTTATGCAATGAAGTGGTTGACGTGACCTGCTCCCCTAAGCCA
GAT
GCATTCAACCCATGTGAAGATATCATGGGGTACAACATCCTCAGAGTCCTGATATGGTTTATCAGCA
TC
CTGGCCATCACTGGGAACATCATAGTGCTAGTGATCCTAACTACCAGCCAATATAAACTCACAGTCCC
C
AGGTTCCTTATGTGCAACCTGGCCTTTGCTGATCTCTGCATTGGAATCTACCTGCTGCTCATTGCATCA
GTT
GATATCCATACCAAGAGCCAATATCACAACTATGCCATTGACTGGCAAACTGGGGCAGGCTGTGATG
CT
GCTGGCTTTTTCACTGTCTTTGCCAGTGAGCTGTCAGTCTACACTCTGACAGCTATCACCTTGGAAAG
A
TGGCATACCATCACGCATGCCATGCAGCTGGACTGCAAGGTGCAGCTCCGCCATGCTGCCAGTGTCATG
GTG
ATGGGCTGGATTTTTGCTTTTGCAGCTGCCCTCTTTCCCATCTTTGGCATCAGCAGCTACATGAAGG
TG
AGCATCTGCCTGCCCATGGATATTGACAGCCCTTTGTCACAGCTGTATGTCATGTCCCTCCTTGTGCT
C
AATGTCCTGGCCTTTGTGGTCATCTGTGGCTGCTATATCCACATCTACCTCACAGTGCGGAACCCCAAC
ATC
GTGTCCTCCTCTAGTGACACCAGGATCGCCAAGCGCATGGCCATGCTCATCTTCACTGACTTCCTCT
GC
ATGGCACCCATTTCTTTCTTTGCCATTTCTGCCTCCCTCAAGGTGCCCCTCATCACTGTGTCCAAAGC
A
AAGATTCTGCTGGTTCTGTTTCACCCCATCAACTCCTGTGCCAACCCCTTCCTCTATGCCATCTTTACC
AAA
AACTTTCGCAGAGATTTCTTCATTCTGCTGAGCAAGTGTGGCTGCTATGAAATGCAAGCCCAAATTT
AT
AGGACAGAAACTTCATCCACTGTCCACAACACCCATCCAAGGAATGGCCACTGCTCTTCAGCTCCCAG
A
GTCACCAGTGGTTCCACTTACATACTTGTCCCTCTAAGTCATTTAGCCCAAAACTAA


Translation (695 aa):
MALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFG
D
LEK
IEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHK
I
HSLQKVL
LDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELP
N
DVFHGASGPVI
LDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFAN
W
RRQ
ISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKP
D
AFNPCEDIMGYNILRVLIWFISILAITGNIIVLVILTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIAS
V
DIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDCKVQLRHAASVM
V
MGWIFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVLAFVVICGCYIHIYLTVRNPN
I
VSSSSDTRIAKRMAMLIFTDFLCMAPISFFAISASLKVPLITVSKAKILLVLFHPINSCANPFLYAIFT
K
NFRRDFFILLSKCGCYEMQAQIYRTETSSTVHNTHPRNGHCSSAPRVTSGSTYILVPLSHLAQN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser