NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS18143.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18143.1 Public Mus musculus 4 Tmod1 21 106 86 CCDS HistoryNCBI Gene:21916Re-query CCDS DB by CCDS ID:18143.1Re-query CCDS DB by GeneID:21916See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 18143.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000107773 ENSMUSP00000103402 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107773Link to Ensembl Protein Viewer:ENSMUSP00000103402Re-query CCDS DB by Nucleotide ID:ENSMUST00000107773Re-query CCDS DB by Protein ID:ENSMUSP00000103402
Original member Current member EBI,WTSI OTTMUST00000015799 OTTMUSP00000007260 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000015799Link to Vega Protein Viewer:OTTMUSP00000007260Re-query CCDS DB by Nucleotide ID:OTTMUST00000015799Re-query CCDS DB by Protein ID:OTTMUSP00000007260
Original member Current member NCBI NM_021883.2 NP_068683.1 Accepted alive Link to Nucleotide Sequence:NM_021883.2Link to Protein Sequence:NP_068683.1Re-query CCDS DB by Nucleotide ID:NM_021883Re-query CCDS DB by Protein ID:NP_068683Link to BLAST:NP_068683.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_068683.1 359 P49813 359 100% 0 0

Chromosomal Locations for CCDS 18143.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 46061015 46061134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 46078314 46078470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 46083544 46083663 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 46090846 46090935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 46092139 46092269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 46093909 46094016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 46096935 46097078 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 46106870 46107014 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 46114314 46114378 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1080 nt):
ATGTCCTACAGACGAGAGCTGGAGAAATATCGAGACCTGGATGAGGATGAAATCCTGGGGGCCCTCACAG
AG
GAGGAGCTGAGGACGCTGGAAAATGAGCTAGATGAACTAGACCCTGATAATGCACTGCTCCCTGCAGG
C
CTGAGGCAGAAGGATCAGACCACCAAGGCACCCACAGGCCCCTTTAAAAGAGAGGAGCTTTTGGACCAC
TTG
GAAAAGCAAGCGAAGGAATTTAAGGACCGAGAAGATCTGGTTCCCTACACAGGGGAGAAACGAGGAA
AG
GTCTGGGTCCCCAAGCAGAAGCCAATGGATCCCGTGCTGGAGAGTGTGACACTGGAGCCAGAACTGGA
G
GAGGCCCTAGCAAATGCCTCGGATGCAGAACTGTGTGACATCGCAGCTATCCTGGGCATGCACACACTC
ATG
AGCAACCAGCAGTACTACCAAGCCTTGGGCAGCAGCTCCATCGTGAACAAGGAGGGGCTCAACAGTG
TG
ATCAAACCCACACAATACAAGCCTGTGCCTGATGAAGAACCAAATTCAACAGACGTAGAGGAAACGCT
G
GAGCGAATAAAGAACAATGACCCAGAACTAGAAGAGGTTAATCTTAACAACATCCGGAATATTCCCATA
CCC
ACCCTCAAGGCATATGCAGAAGCCCTGAAAGAGAACTCCTATGTGAAGAAGTTCAGCATCGTGGGGA
CC
CGCAGCAATGACCCTGTGGCGTTTGCCCTTGCTGAAATGCTGAAAGTGAACAAGGTGCTGAAGACCCT
G
AACGTGGAGTCCAACTTCATCTCTGGAGCTGGGATCCTGCGCCTGGTGGAAGCTCTCCCCCACAACACT
TCT
CTGGTCGAGCTGAAAATCGATAACCAGAGCCAACCTTTGGGCAACAAAGTGGAAATGGAGATCGTGA
AC
ATGTTGGAGAAAAACACAACGCTCCTCAAATTTGGCTACCACTTTACCCAGCAGGGGCCCCGGCTGCG
G
GCATCCAACGCCATGATGAGCAACAACGACCTTGTGAGGAAGAGGAGGCTCGCAGACCTGACGGGGCCT
ATT
ATCCCCAAGTGCCGCAGCGGTGTCTAG


Translation (359 aa):
MSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDH
L
EKQAKEFKDREDLVPYTGEKR
GKVWVPKQKPMDPVLESVTLEPELEEALANASDAELCDIAAILGMHTL
M
SNQQYYQALGSSSIVNKEGLN
SVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPELEEVNLNNIRNIPI
P
TLKAYAEALKENSYVKKFSIVGTRSNDPVAF
ALAEMLKVNKVLKTLNVESNFISGAGILRLVEALPHNT
S
LVELKIDNQ
SQPLGNKVEMEIVNMLEKNTTLLKFGYHFTQQGPRLRASNAMMSNNDLVRKRRLADLTGP
I
IPKCRSGV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser