NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, February 19, 2020, starting at 8:00 a.m. EST for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS18135.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18135.1 Public Mus musculus 4 Trmt10b 23 108 98 CCDS HistoryNCBI Gene:69934Re-query CCDS DB by CCDS ID:18135.1Re-query CCDS DB by GeneID:69934See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 18135.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000044673.8 ENSMUSP00000041052.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000044673.8Link to Ensembl Protein Viewer:ENSMUSP00000041052.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000044673Re-query CCDS DB by Protein ID:ENSMUSP00000041052
Original member Current member NCBI NM_027266.4 NP_081542.2 Accepted alive Link to Nucleotide Sequence:NM_027266.4Link to Protein Sequence:NP_081542.2Re-query CCDS DB by Nucleotide ID:NM_027266Re-query CCDS DB by Protein ID:NP_081542Link to BLAST:NP_081542.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081542.2 318 Q9D075 318 100% 0 0

Chromosomal Locations for CCDS 18135.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 45300445 45300627 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 45301236 45301350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 45304264 45304388 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 45305744 45305896 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 45307892 45307970 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 45308497 45308564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 45314283 45314406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 45315012 45315121 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (957 nt):
ATGGACTGTAAGTCGGAAGAGAGCGCCCAGAGAACAGACTCACAGGCCTTTCAGGAACCAGACGGACTCC
CA
GAGGCCGGAGGTGAAGATGGACTCTCTGAAAGCTTCCAGCTTCTGCAGGTGGATGTGGAGTACGAGCG
C
CCAGAAGAGACCAGCCCTGCAAACAGTGCCGTGTGGAGCTCGAAAAACATGCAAAGAAAACAGAGACAC
TGG
GAAAGGATAGTCTCCTCAAAGAAGAGCAAAAGGAAGCAGGAAAGAGAACGAAGGAAAGCCAAGCGTG
CA
GAAGACCCCGGTAACGGCACCTGCCCACAGCACAGCAAACGCTTTTTGAAAGCCTTAACCAAAGAGAA
A
CTTTTGGAAGCCAAACACTCAGGACCAAGACTATGTGTTGACTTGAGCATGACCCAGCACATGTCAAAG
AAG
GAATTGAGTAGGTTGGCGGGACAGATTCGAAGGTTGTATGGTTCGAACAAAAAAGCCAGCAGGCCCT
TT
TGGATCTGCCTTACTGGATTCTCAACTGCCAGCCCCCTCTATGAGGAGTGTCTGAGGATGAACGACGG
G
TTTTCTGCTTACTTGCTGGATGTGACAGAAGAAGACTGCTTTAGCCTTTTTCCTCTGGAAACCCTTGTG
TAC
CTGACTCCTGACTCCGAACACTCCCTTGAAGACATTGATCAGAGCACAGTTTACGTTATTGGTGGAC
TT
GTAGATGAGAGCATTCAGAAGAAGGTGACATTTCAAAAAGCCCGAGAATACTCTGTCAAGACAGCCCG
C
TTGCCAATCCAGGAATACATGATCAAGCGCCAGAATGAGAAAAACTACCATTCGGAAATATTGGCCATC
AAC
CAAGTGTTCGATATCCTGTCTACTTACTTTGAAACTCGTAACTGGCCTGAAGCACTGAAGAAAGGAG
TT
TCTCCAGGAAAAGGCTACGTTCTTCAGAATTCAGCAGAAGGATGA


Translation (318 aa):
MDCKSEESAQRTDSQAFQEPDGLPEAGGEDGLSESFQLLQVDVEYERPEETSPANSAVWSSKNMQRKQRH
W
ERIVSSKKSKRKQERERRKAKRAEDPGN
GTCPQHSKRFLKALTKEKLLEAKHSGPRLCVDLSMTQHMSK
K
ELSRLAGQIRRLYGSNKKASRPFWICLTGFSTASPLYEECLRMNDGFSAYLLDVTEEDCFSLFPLETLV
Y
LTPDSEH
SLEDIDQSTVYVIGGLVDESIQKKVTFQKAREYSVKTARLPIQEYMIKRQNEKNYHSEILAI
N
Q
VFDILSTYFETRNWPEALKKGVSPGKGYVLQNSAEG



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser