NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS18010.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18010.1 Public Mus musculus 4 Ufl1 21 106 86 CCDS HistoryNCBI Gene:67490Re-query CCDS DB by CCDS ID:18010.1Re-query CCDS DB by GeneID:67490See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 18010.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000102994 ENSMUSP00000100059 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000102994Link to Ensembl Protein Viewer:ENSMUSP00000100059Re-query CCDS DB by Nucleotide ID:ENSMUST00000102994Re-query CCDS DB by Protein ID:ENSMUSP00000100059
Original member Current member EBI,WTSI OTTMUST00000010756 OTTMUSP00000005060 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000010756Link to Vega Protein Viewer:OTTMUSP00000005060Re-query CCDS DB by Nucleotide ID:OTTMUST00000010756Re-query CCDS DB by Protein ID:OTTMUSP00000005060
Original member NCBI NM_026194.4 NP_080470.2 Updated not alive Link to Nucleotide Sequence:NM_026194.4Link to Protein Sequence:NP_080470.2Re-query CCDS DB by Nucleotide ID:NM_026194Re-query CCDS DB by Protein ID:NP_080470
Current member NCBI NM_026194.5 NP_080470.2 Accepted alive Link to Nucleotide Sequence:NM_026194.5Link to Protein Sequence:NP_080470.2Re-query CCDS DB by Nucleotide ID:NM_026194Re-query CCDS DB by Protein ID:NP_080470Link to BLAST:NP_080470.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080470.2 793 Q8CCJ3-3 793 100% 0 0

Chromosomal Locations for CCDS 18010.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 25250470 25250688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25251336 25251516 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25251932 25252017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25252299 25252379 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25254559 25254689 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25254771 25254934 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25255998 25256115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25259215 25259337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25262206 25262326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25265423 25265602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25267692 25267867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25269028 25269174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25270560 25270618 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25275806 25275936 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25277989 25278103 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25278604 25278701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25279346 25279374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25280623 25280768 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 25281676 25281752 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2382 nt):
ATGGCGGACGCCTGGGAGGAGATCCGGCGGCTGGCGGCTGACTTCCAGCGGGCGCAGTTTGCAGAGTCCA
CG
CAAAGGTTGTCAGAGCGGAACTGCATTGAGATTGTGAATAAATTGATCTCTCAGAAACAGCTGGAAGT
A
GTCCATACACTTGACGGCAAGGAATATATCACTCCAGCCCAAATCAGTAAAGAAATGAGAGACGAGCTA
CAT
GTCCGAGGTGGTCGAGTAAACATTGTTGACTTACAACAGGTTATTAATGTGGACCTGACTCATATCG
AG
AGTAGAGTCAGTGATATTATTAAATCAGAGAAGCACGTGCAGATGGTACTGGGACAACTGATTGATGA
G
AACTATCTGGATCAGTTATCAGAAGAGGTGAATGATAAATTGCAAGAAAGTGGTCAAGTAACTGTCTCA
GAA
CTGTGTAAAGCCTATGACCTTCCTGGGGATTTTCTGACACAGGCATTAACTCAGCGACTTGGCCGGA
TT
ATCAATGGCCATCTGGACCTTGATAACAGAGGAGTGATTTTCACTGAGGCCTTTGTAGCTCGCCATAA
A
GCACGTATCCGCGGACTCTTCAGTGCCATTACACGGCCTACACCAGTGAACTCTTTGGTTTCAAAATAT
GGA
TTTCAGGAACAGCTCCTTTACTCTGTGCTCGAGGACCTCGTCAGCACTGGCCGCTTACGAGGCACCG
TG
GTCGGCGGGCGACAGGATAAAGCAGTCTTTGTCCCTGACATCTACTCCAGGACACAGAGTACTTGGGT
G
GACTCCTTTTTCAGGCAGAATGGCTATCTAGAATTTGACGCTTTATCCAGACTTGGAATCCCAGATGCT
GTG
AACTATATAAAGAAAAGGTATAAGAATACCCAACTCTTGTTTTTGAAGGCAACTTGTGTTGGCCAAG
GA
CTCGTAGACCAGGTGGAAGCATCCGTAGAGGAAGCCATCAGCTCAGGGACCTGGGTTGACATTTCGCC
T
CTGCTACCCAGTTCCTTGTCAGTTGAAGATGCTGCTATGCTGCTCCAGCAGGTGATGAGACCATTCGGC
AAG
CTCGCTTCAGCTATAGTCTTTAGTGACACGGTTGTGGTGAGTGAAAAGTTCATAACTGACTGCACAG
GA
CTGTTCAGCGAACGGATGCACCAAAAAGCTGAGAAGGAAATGAAAAATAATCCTGTGCATTTAATCAC
T
GAAGAAGATCTGAAACAAATTTCCATTTTAGAAAGTGTTAATACAAGTAAAAAGGATAAAAAAGATGAA
CGC
AGGAAGAAAGCAACAGAGGGCTCTGGAAGTGTAAGAGGAGGAGGAGGGGGCAATGCCAGAGAATATA
AA
ATTAAGAAAACCAAGAAGAAGGGAAGAAAAGATGAGGACAGTGATGATGAGTCCCAGTCGTCGCATGG
T
GGAAAGAAGAAGCCGGACATCACATTCATGTTCCAGGATGAAATTGAAGATTGCTTAAGGAAACACATT
CAG
GATGCCCCTGAGGAGTTTATTTCAGAGCTTGCAGAATACTTAATAAAGCCTCTTAATAAAATGTATC
TT
GAGGTAGTACGTTCAGTCTTCATGTCTTCAACATCTGCTTCTGGAACTGGCAGAAAACGCACAATCAA
G
GACTTACAAGAAGAGGTTTCAAACCTATACAATAATATCAGATTATTTGAAAAGGGAATGAAATATTTT
GCA
GATGACACACAGACTGCTCTTACCAAGCACTTGCTGAAGACAGTGTGTACCGATATCACTAACCTCA
TG
TTCAACTTCCTAGCCTCAGATTTCCTCATGGCAGTGGAGGAGCCTGCAGCCATTACAAGTGATATAAG
A
AAAAAAATTTTAAGCAAATTGACAGAAGAAACCAAAGTAGCTCTCACAAAACTCCATAACTCTCTCAAT
GAA
AAAAGCATAGAAGACTTCCTGTCTTGCCTGGATTCTGCCACAGAAGCGTGTGACATTATGGTGAAAA
AG
GGAGACAAGAAAAGGGAAAGACAAATCCTCTTCCAGCATCGACAGGCTCTGTGTGAGCAGCTGAAGGT
C
ACAGAAGACCCTGCTCTGATTTTACACCTCACAGCAGTCCTGTTATTTCAGCTCTCAACCCACAGCATG
CTC
CACGCACCTGGAAGGTGTGTCCCACAGATCATCGCGTTTCTTCACAGCAAAATCCCAGAGGATCAAC
AT
ACTCTCTTGGTAAAATATCAAGGTTTGGTTGTGAAACAGTTAGTCAGTCAAAATAAGAAGACTGGGCA
G
GGAGAGGATCCGTCAAGCGATGAATTAGACAAGGAACAACATGATGTCACAAACGCTACTCGGAAAGAG
CTT
CAGGAACTGTCATTATCCATTAAGGACCTTGTTCTCAAGTCCAGGAAATCATCTGTCACAGAGGAGT
AA


Translation (793 aa):
MADAWEEIRRLAADFQRAQFAESTQRLSERNCIEIVNKLISQKQLEVVHTLDGKEYITPAQISKEMRDEL
H
VRG
GRVNIVDLQQVINVDLTHIESRVSDIIKSEKHVQMVLGQLIDENYLDQLSEEVNDKLQESGQVTVS
E
LCKAYDLPGDFLTQ
ALTQRLGRIINGHLDLDNRGVIFTEAFVARHKARIRGLFSAITRPTPVNSLVSKY
G
FQEQLLY
SVLEDLVSTGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDA
V
NYIKKRYKNTQLLFLKATCVGQGLVDQVEASVEEAISSGTWVDIS
PLLPSSLSVEDAAMLLQQVMRPFG
K
LASAIVFSDTVVVSEKFITDCTGLFSERMHQKAEK
EMKNNPVHLITEEDLKQISILESVNTSKKDKKDE
R
RKKAT
EGSGSVRGGGGGNAREYKIKKTKKKGRKDEDSDDESQSSHGGKKKPDITFMFQDEIEDCLRKHI
Q
DAPEEFISELAEYLI
KPLNKMYLEVVRSVFMSSTSASGTGRKRTIKDLQEEVSNLYNNIRLFEKGMKYF
A
DDTQTALTKHLLKTVCTDITNLMFNFLASDFLMAVEEPAAITSDIRKKILSKLTEETKVALTKLHNSLN
E
K
SIEDFLSCLDSATEACDIMVKKGDKKRERQILFQHRQALCEQLKVTEDPALILHLTAVLLFQLSTHSM
L
HAPGRCVPQIIAFLHSKIPE
DQHTLLVKYQGLVVKQLVSQNKKTGQGEDPSSDELDKEQHDVTNATRKE
L
QELSLSIKDLVLKSRKSSVTEE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser