NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS17830.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17830.1 Public Mus musculus 3 Pitx2 23 108 98 CCDS HistoryNCBI Gene:18741Re-query CCDS DB by CCDS ID:17830.1Re-query CCDS DB by GeneID:18741See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17830.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000174661.8 ENSMUSP00000133756.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000174661.8Link to Ensembl Protein Viewer:ENSMUSP00000133756.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000174661Re-query CCDS DB by Protein ID:ENSMUSP00000133756
Original member Current member NCBI NM_011098.4 NP_035228.2 Accepted alive Link to Nucleotide Sequence:NM_011098.4Link to Protein Sequence:NP_035228.2Re-query CCDS DB by Nucleotide ID:NM_011098Re-query CCDS DB by Protein ID:NP_035228Link to BLAST:NP_035228.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035228.2 317 P97474-1 317 100% 0 0

Chromosomal Locations for CCDS 17830.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 129203947 129203992 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 129204440 129204577 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 129215639 129215844 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 129218334 129218897 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (954 nt):
ATGGAGACCAATTGTCGCAAACTAGTGTCGGCCTGCGTGCAATTAGGCGTGCAGCCGGCAGCCGTTGAAT
GT
CTCTTCTCCAAAGACTCCGAAATCAAAAAGGTCGAGTTCACGGACTCTCCCAAGAGCCGGAAAGAGTC
G
GCCAGCAGCAAGCTGTTCCCGCGGCAGCACCCCGGCGCCAATGAGAAAGATAAGGGCCAGCAAGGAAAG
AAT
GAGGATGTGGGCGCCGAGGACCCGTCCAAGAAGAAGCGGCAACGCCGGCAGAGGACTCATTTCACTA
GC
CAGCAGCTGCAGGAGCTGGAAGCCACTTTCCAGAGAAACCGCTACCCAGACATGTCCACTCGCGAAGA
A
ATCGCCGTGTGGACCAACCTTACGGAAGCCCGAGTCCGGGTTTGGTTCAAGAATCGCCGGGCCAAATGG
AGA
AAGCGGGAACGCAACCAGCAGGCCGAGCTGTGCAAGAATGGCTTTGGGCCGCAGTTCAACGGGCTCA
TG
CAGCCCTACGATGACATGTACCCCGGCTATTCGTACAACAATTGGGCTGCCAAGGGCCTCACGTCAGC
G
TCTCTGTCCACCAAGAGCTTCCCCTTCTTCAACTCCATGAACGTCAATCCCCTGTCCTCTCAGAGTATG
TTT
TCCCCGCCCAACTCCATCTCATCTATGAGTATGTCGTCCAGCATGGTGCCCTCCGCGGTGACCGGCG
TC
CCGGGCTCCAGCCTCAATAGCCTGAATAACTTGAACAACCTGAGCAGCCCGTCGCTGAATTCCGCGGT
G
CCCACGCCCGCCTGTCCTTACGCGCCGCCGACTCCTCCGTACGTTTATAGGGACACATGTAACTCGAGC
CTG
GCCAGCCTGAGACTGAAAGCAAAGCAGCACTCCAGCTTCGGCTACGCCAGCGTGCAGAACCCGGCCT
CC
AACCTGAGTGCTTGCCAGTATGCAGTCGACCGGCCGGTGTGA


Translation (317 aa):
METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPKSRKESASSKLFPRQHPGANEKDKGQQGK
N
EDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVR
VWFKNRRAKW
R
KRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSM
F
SPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSS
L
ASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser