NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS1755.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1755.1 Public Homo sapiens 2 IFT172 22 109 92 CCDS HistoryNCBI Gene:26160Re-query CCDS DB by CCDS ID:1755.1Re-query CCDS DB by GeneID:26160See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1755.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000260570.7 ENSP00000260570.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000260570.7Link to Ensembl Protein Viewer:ENSP00000260570.3Re-query CCDS DB by Nucleotide ID:ENST00000260570Re-query CCDS DB by Protein ID:ENSP00000260570
Original member NCBI NM_015662.2 NP_056477.1 Updated not alive Link to Nucleotide Sequence:NM_015662.2Link to Protein Sequence:NP_056477.1Re-query CCDS DB by Nucleotide ID:NM_015662Re-query CCDS DB by Protein ID:NP_056477
Current member NCBI NM_015662.3 NP_056477.1 Accepted alive Link to Nucleotide Sequence:NM_015662.3Link to Protein Sequence:NP_056477.1Re-query CCDS DB by Nucleotide ID:NM_015662Re-query CCDS DB by Protein ID:NP_056477Link to BLAST:NP_056477.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_056477.1 1749 Q9UG01-1 1749 100% 0 0

Chromosomal Locations for CCDS 1755.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 27444432 27444521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27445014 27445105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27445296 27445449 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27445745 27445843 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27445929 27445988 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27446260 27446355 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27447515 27447634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27447812 27447922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27448915 27449031 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27449294 27449380 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27449499 27449562 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27449691 27449800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27449998 27450096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27453384 27453513 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27453630 27453739 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27453982 27454162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27454354 27454418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27454567 27454660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27456511 27456653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27457639 27457755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27457841 27457976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27458126 27458223 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27458779 27458868 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27459378 27459522 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27459709 27459829 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27461015 27461093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27461269 27461517 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27461759 27461836 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27462701 27462793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27463097 27463181 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27465411 27465518 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27465746 27465882 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27470928 27471095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27472250 27472362 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27476641 27476726 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27477217 27477320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27477559 27477612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27477995 27478156 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27479509 27479604 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27480026 27480149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27481046 27481260 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27483289 27483376 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27483580 27483659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27483872 27483937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27484227 27484266 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27485018 27485130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27485360 27485503 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27489615 27489653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5250 nt):
ATGCACTTGAAGCACCTGAGGACCCTGCTGAGCCCTCAGGATGGAGCTGCAAAGGTGACCTGCATGGCTT
GG
TCCCAGAACAATGCCAAATTTGCTGTCTGCACAGTGGACCGAGTGGTCTTGCTGTATGATGAACATGG
A
GAACGGAGAGATAAATTCTCCACCAAACCAGCTGACATGAAGTATGGCAGGAAGAGCTATATGGTGAAG
GGC
ATGGCTTTTTCTCCTGATTCCACTAAAATTGCCATAGGACAGACTGACAACATCATCTATGTCTACA
AG
ATTGGAGAAGATTGGGGTGACAAGAAAGTCATCTGCAACAAGTTCATCCAGACGAGTGCTGTCACTTG
T
CTGCAATGGCCGGCAGAATACATCATTGTCTTTGGACTGGCTGAAGGGAAGGTTCGTTTAGCAAACACC
AAA
ACTAATAAATCATCTACCATCTATGGGACAGAGTCTTACGTGGTGTCCCTGACAACAAATTGCTCTG
GG
AAAGGAATTCTCTCTGGTCATGCAGATGGTACCATCGTTAGGTATTTCTTTGATGATGAAGGCTCTGG
A
GAGTCACAGGGGAAGTTGGTTAACCACCCGTGTCCACCCTATGCCTTGGCATGGGCAACCAATAGCATC
GTG
GCTGCAGGCTGTGATCGGAAAATTGTAGCCTATGGAAAAGAAGGTCACATGCTACAAACTTTTGATT
AT
AGCCGTGACCCTCAGGAGCGGGAGTTCACCACAGCTGTATCAAGTCCTGGGGGCCAGTCTGTTGTGCT
A
GGAAGTTATGACAGGCTTCGGGTGTTCAACTGGATCCCTCGAAGAAGCATCTGGGAAGAGGCAAAGCCC
AAG
GAGATTACCAATTTATACACCATCACTGCCTTGGCCTGGAAGCGGGATGGCTCACGGCTCTGTGTGG
GC
ACACTATGTGGTGGGGTGGAACAGTTTGACTGCTGCCTCCGAAGGAGTATTTACAAGAACAAGTTTGA
G
TTGACGTATGTGGGACCTAGCCAGGTGATTGTGAAGAACCTGTCATCAGGAACCCGAGTGGTGCTCAAG
TCA
CACTATGGCTATGAGGTGGAAGAGGTGAAAATCCTAGGAAAGGAACGTTACTTGGTGGCTCACACAT
CA
GAAACACTGCTGCTGGGGGACCTGAACACTAATCGGCTTAGTGAGATAGCCTGGCAAGGATCTGGTGG
C
AATGAGAAGTATTTCTTTGAAAATGAGAATGTATGCATGATCTTCAATGCCGGAGAGCTAACCCTGGTG
GAA
TATGGGAATAATGACACCCTGGGTTCTGTACGCACTGAATTCATGAACCCCCACCTCATCAGTGTTC
GT
ATTAATGAGAGGTGTCAGCGAGGAACAGAAGATAATAAGAAATTGGCTTATCTTATTGATATTAAGAC
T
ATTGCTATAGTGGATCTGATTGGTGGCTACAACATTGGCACCGTCAGCCATGAGAGCCGTGTGGATTGG
CTG
GAACTTAATGAGACTGGACACAAGCTCCTCTTCAGGGACCGGAAACTTCGTTTGCATCTGTATGATA
TT
GAAAGCTGCTCTAAGACAATGATCCTCAACTTCTGCTCCTATATGCAGTGGGTCCCAGGAAGTGACGT
G
CTGGTAGCTCAGAACCGAAACAGTCTGTGTGTATGGTACAACATTGAGGCACCTGAGAGAGTCACCATG
TTC
ACTATTAGGGGTGATGTTATAGGTCTGGAGCGGGGCGGGGGAAAGACCGAGGTGATGGTGATGGAAG
GT
GTGACTACTGTTGCCTACACATTGGATGAGGGCCTCATCGAGTTTGGAACAGCCATTGATGATGGCAA
C
TACATCCGGGCAACAGCCTTCTTAGAGACTCTGGAAATGACCCCAGAAACAGAGGCAATGTGGAAAACC
TTG
AGTAAACTGGCACTAGAGGCAAGGCAACTACACATTGCGGAGAGGTGCTTTTCTGCTTTGGGCCAAG
TA
GCAAAAGCTCGATTCCTGCATGAGACCAATGAGATTGCAGATCAAGTATCCCGGGAATATGGCGGAGA
A
GGAACAGACTTTTATCAGGTCCGAGCACGTCTAGCCATGCTGGAAAAGAACTACAAACTGGCTGAAATG
ATC
TTTTTGGAACAGAATGCTGTGGAGGAGGCCATGGGCATGTACCAGGAGCTACACCGTTGGGATGAGT
GT
ATCGCTGTGGCTGAAGCCAAGGGGCACCCAGCCCTGGAGAAGCTACGTCGTAGTTACTACCAGTGGCT
G
ATGGACACACAGCAAGAGGAGCGAGCAGGTGAACTACAGGAGAGCCAAGGGGATGGGCTAGCAGCCATC
AGC
CTCTACCTCAAAGCTGGGCTCCCTGCCAAAGCTGCTCGGCTGGTGCTGACCCGAGAGGAACTGCTAG
CC
AACACAGAGCTGGTAGAACACATCACTGCAGCCCTTATCAAGGGGGAACTCTACGAAAGGGCAGGTGA
T
CTCTTTGAGAAGATTCACAATCCACAGAAGGCCCTGGAGTGCTACCGTAAAGGCAACGCATTCATGAAA
G
CG
GTAGAGCTGGCTCGATTGGCCTTCCCAGTGGAGGTGGTGAAACTAGAGGAGGCATGGGGGGACCACC
TG
GTGCAGCAGAAGCAGCTTGATGCAGCCATTAATCACTACATCGAAGCCAGGTGCTCCATTAAGGCAAT
T
GAGGCCGCCCTGGGTGCCCGCCAGTGGAAGAAGGCAATTTATATATTAGATCTACAGGACCGGAACACT
GCA
TCCAAATACTATCCTCTCGTGGCCCAACACTATGCATCCCTGCAGGAGTATGAGATTGCTGAGGAGC
TC
TATACTAAGGGAGATCGGACAAAAGATGCCATAGACATGTACACCCAGGCTGGTCGTTGGGAACAAGC
C
CACAAGCTGGCGATGAAATGCATGAGACCAGAAGATGTGTCAGTGCTATACATCACTCAGGCCCAGGAA
ATG
GAGAAGCAGGGCAAGTACCGTGAGGCTGAAAGGCTATATGTGACAGTACAAGAGCCTGATCTTGCCA
TC
ACCATGTACAAAAAGCACAAGTTGTATGATGACATGATCCGCCTGGTAGGGAAGCACCATCCAGATCT
C
CTCAGTGATACACACCTACATCTGGGCAAGGAGCTGGAGGCTGAAGGCCGACTACAGGAGGCTGAGTAC
CAC
TACCTCGAGGCCCAGGAATGGAAGGCAACAGTGAACATGTACCGGGCCAGTGGGCTTTGGGAAGAGG
CC
TACAGGGTGGCCAGAACTCAAGGAGGGGCTAATGCCCACAAACACGTGGCCTATCTGTGGGCAAAGAG
C
CTGGGAGGAGAGGCTGCAGTTAGACTGCTTAATAAGCTGGGACTCCTGGAAGCTGCTGTTGACCACGCT
GCA
GACAATTGCTCCTTTGAATTTGCGTTTGAACTCTCTCGGCTGGCCCTCAAGCACAAAACCCCCGAGG
TT
CATCTCAAATATGCTATGTTCCTGGAGGATGAGGGTAAATTCGAAGAGGCTGAAGCTGAATTCATCAG
A
GCTGGTAAACCCAAGGAGGCAGTCCTCATGTTTGTCCATAACCAGGATTGGGAGGCAGCTCAGCGTGTG
GCT
GAGGCTCACGACCCTGACAGTGTCGCCGAGGTGCTTGTGGGACAGGCCCGGGGGGCCTTGGAGGAGA
AG
GACTTTCAGAAAGCAGAAGGGCTGCTGCTCCGGGCCCAGAGACCAGGCCTGGCCCTCAATTATTATAA
G
GAGGCTGGATTATGGAGTGACGCTCTGCGCATCTGCAAGGACTATGTGCCCAGCCAGCTGGAGGCTCTG
CAG
GAAGAATATGAGCGGGAAGCTACTAAGAAGGGGGCCAGGGGTGTGGAGGGATTTGTGGAACAAGCTC
GA
CACTGGGAGCAGGCTGGAGAGTACAGCCGTGCCGTGGACTGCTACCTCAAAGTGCGAGACTCTGGAAA
C
AGCGGCCTGGCGGAGAAGTGCTGGATGAAGGCAGCTGAACTCTCCATCAAGTTTCTGCCTCCCCAACGT
AAT
ATGGAAGTCGTTCTGGCTGTAGGACCCCAGCTGATTGGAATTGGAAAGCACAGTGCAGCTGCAGAGC
TC
TATCTGAATCTGGACCTTGTCAAGGAAGCAATCGATGCTTTCATCGAGGGTGAGGAGTGGAACAAGGC
G
AAGCGTGTAGCTAAGGAGTTAGATCCCAGGTATGAAGACTATGTGGACCAGCATTATAAAGAGTTCCTC
AAG
AATCAGGGCAAAGTGGACTCGCTGGTGGGTGTGGATGTGATAGCTGCTTTGGACCTGTATGTGGAGC
AG
GGCCAGTGGGACAAGTGCATTGAAACAGCTACCAAGCAGAACTACAAGATTCTGCACAAGTATGTGGC
T
TTGTATGCAACTCACTTGATCCGGGAGGGTAGCTCTGCCCAGGCATTGGCCCTGTATGTACAGCACGGA
GCC
CCTGCTAACCCACAGAACTTCAATATCTACAAAAGGATCTTCACTGACATGGTGAGCTCTCCTGGAA
CC
AACTGTGCCGAGGCCTATCATAGCTGGGCTGATCTTCGAGATGTCCTCTTCAACCTGTGTGAAAACCT
G
GTGAAGTCCAGTGAGGCAAACTCTCCAGCCCATGAGGAGTTCAAGACGATGCTGCTGATCGCTCATTAC
TAT
GCCACGCGCTCTGCAGCCCAGAGTGTCAAACAGCTGGAAACCGTGGCTGCCAGGCTTTCTGTTTCAC
TC
TTGCGTCACACCCAGCTACTACCTGTAGACAAAGCCTTCTATGAAGCAGGCATTGCTGCCAAGGCAGT
T
GGCTGGGATAACATGGCATTCATCTTCCTCAATCGCTTTTTGGACCTGACCGATGCAATCGAGGAAGGG
ACT
CTAGATGGCCTTGACCACTCTGATTTTCAGGATACAGACATTCCCTTTGAGGTGCCACTCCCAGCTA
AG
CAGCATGTACCGGAGGCTGAGAGAGAAGAGGTTCGAGACTGGGTGCTTACAGTCTCCATGGACCAGCG
G
CTGGAGCAGGTTCTGCCTCGGGATGAGCGTGGCGCCTACGAGGCCTCCCTAGTGGCAGCGAGCACTGGT
GTT
CGAGCCCTGCCCTGCCTTATTACAGGATACCCCATTCTGAGGAACAAAATTGAATTTAAGCGGCCAG
GG
AAGGCTGCTAACAAGGACAACTGGAATAAATTCCTTATGGCCATCAAGACCTCCCACAGCCCAGTGTG
C
CAGGACGTGCTGAAATTCATCAGTCAGTGGTGTGGAGGGCTCCCCAGCACCAGCTTTTCCTTTCAGTAG


Translation (1749 aa):
MHLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADMKYGRKSYMVK
G
MAFSPDSTKIAIGQTDNIIYVYKIGED
WGDKKVICNKFIQTSAVTCLQWPAEYIIVFGLAEGKVRLANT
K
TNKSSTIYGTESYVVSLTT
NCSGKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAWATNSI
V
AAGCDRKIVAYGKEGHMLQTFDYSRDPQEREFTTAVSSPGGQSVVLGSYD
RLRVFNWIPRRSIWEEAKP
K
EITNLYTITALAWKRDGSRLCV
GTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKNLSSGTRVVLK
S
HYGYEVEEVKILGKERYLVAHTSETLLLGDLNTNRLSE
IAWQGSGGNEKYFFENENVCMIFNAGELTLV
E
YGNNDTLGSVRTEFMNPHLI
SVRINERCQRGTEDNKKLAYLIDIKTIAIVDLIGGYNIGTVSHESRVDW
L
ELNETGHKLLFRDRKLR
LHLYDIESCSKTMILNFCSYMQWVPGSDVLVAQNRNSLCVWYNIEAPERVTM
F
TIR
GDVIGLERGGGKTEVMVMEGVTTVAYTLDEGLIEFGTAIDDGNYIRATAFLETLEMTPETEAMWKT
L
SKLALEARQLHIAE
RCFSALGQVAKARFLHETNEIADQVSREYGGEGTDFYQVRARLAMLEKNYKLAEM
I
FLEQ
NAVEEAMGMYQELHRWDECIAVAEAKGHPALEKLRRSYYQWLMDTQQEERAGELQESQGDGLAAI
S
LYLKAGLPAKAARLVLTREELLANTELVEHITAALIKGELYER
AGDLFEKIHNPQKALECYRKGNAFMK
A
VELARLAFPVEVVKLEEAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQWKKAIYILDLQDRNT
A
SKYYPLVAQHYASLQEYE
IAEELYTKGDRTKDAIDMYTQAGRWEQAHKLAMKCMRPEDVSVLYITQAQE
M
EKQGKYREAE
RLYVTVQEPDLAITMYKKHKLYDDMIRLVGKHHPDLLSDTHLHLGKELEAEGRLQEAEY
H
YLEAQEWKATVNMYRASGLWEEAYR
VARTQGGANAHKHVAYLWAKSLGGEAAVRLLNKLGLLEAAVDHA
A
DN
CSFEFAFELSRLALKHKTPEVHLKYAMFLEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRV
A
EAHDPDSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYK
EAGLWSDALRICKDYVPSQLEAL
Q
EEYEREATKKGA
RGVEGFVEQARHWEQAGEYSRAVDCYLKVRDSGNSGLAEKCWMKAAELSIKFLPPQR
N
MEVVLAVGPQLIGIGKHSA
AAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQHYKEFL
K
NQGKVDS
LVGVDVIAALDLYVEQGQWDKCIETATKQNYKILHKYVALYATHLIREGSSAQALALYVQHG
A
PANPQ
NFNIYKRIFTDMVSSPGTNCAEAYHSWADLRDVLFNLCENLVKSSEANSPAHEEFKTMLLIAHY
Y
ATRSAAQSVKQL
ETVAARLSVSLLRHTQLLPVDKAFYEAGIAAKAVGWDNMAFIFLNRFLDLTDAIEEG
T
LDGLDHSDFQDTDIPFEVPLPAKQHVP
EAEREEVRDWVLTVSMDQRLEQVLPRDERGAYEASLVAASTG
V
RALPCLIT
GYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGGLPSTSFSFQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser