NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS17318.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17318.1 Public Mus musculus 3 Cetn4 21 106 86 CCDS HistoryNCBI Gene:207175Re-query CCDS DB by CCDS ID:17318.1Re-query CCDS DB by GeneID:207175See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 17318.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000102955 ENSMUSP00000100020 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000102955Link to Ensembl Protein Viewer:ENSMUSP00000100020Re-query CCDS DB by Nucleotide ID:ENSMUST00000102955Re-query CCDS DB by Protein ID:ENSMUSP00000100020
Original member Current member EBI,WTSI OTTMUST00000016994 OTTMUSP00000007836 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000016994Link to Vega Protein Viewer:OTTMUSP00000007836Re-query CCDS DB by Nucleotide ID:OTTMUST00000016994Re-query CCDS DB by Protein ID:OTTMUSP00000007836
Original member Current member NCBI NM_145825.2 NP_665824.1 Accepted alive Link to Nucleotide Sequence:NM_145825.2Link to Protein Sequence:NP_665824.1Re-query CCDS DB by Nucleotide ID:NM_145825Re-query CCDS DB by Protein ID:NP_665824Link to BLAST:NP_665824.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_665824.1 168 Q8K4K1-1 168 100% 0 0

Chromosomal Locations for CCDS 17318.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 37309092 37309181 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 37309345 37309482 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 37309937 37310065 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 37310293 37310439 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 37312357 37312359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (507 nt):
ATGGCATCCAGCCAGCGCATAACTTTAGACCAATGGAAGAAAAAAGCAGCAAAAGTTGAACTGAATGACA
CC
CAGAAGCAAGAAATTAAAGAGGCCTTTGACTTATTCGATATTGATGGATCTGGAACCATAGATCTGAA
A
GAACTGAAGATTGCAATGAGGGCCTTAGGCTTTGAGCCAAAGAAAGAAGAAGTAAAACAACTGATCGCT
GAA
ATCGACAAGGAAGGGACTGGCACCATTTGTTTTGAAGATTTTTTTGCCATCATGAGCGTAAAAATGA
GT
GAAAAAGATGAAAAAGAAGAAATACTGAAGGCATTTAAATTATTTGATGACGATGCTACGGGAAGCAT
A
TCACTAAATAACATCAAGAGGGTTGCCAAGGAGCTAGGGGAAAACTTAACCGAAGATGAATTACAGGAA
ATG
CTTGATGAAGCTGATCGTGACGGGGATGGAGAGATTAATGAGGAAGAATTCTTGAAGATGATGAAGA
AG
ACCAGCCTTTATTAG


Translation (168 aa):
MASSQRITLDQWKKKAAKVELNDTQKQEIKEAFDLFDIDGSGTIDLKELKIAMRALGFEPKKEEVKQLIA
E
IDKEGTGTICFEDFFAIMSVKM
SEKDEKEEILKAFKLFDDDATGSISLNNIKRVAKELGENLTEDELQE
M
LDEADRDGDGEINEEEFLKMMKKTSLY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser