NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS17313.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17313.1 Public Mus musculus 3 Ccna2 23 108 98 CCDS HistoryNCBI Gene:12428Re-query CCDS DB by CCDS ID:17313.1Re-query CCDS DB by GeneID:12428See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17313.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000029270.9 ENSMUSP00000029270.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029270.9Link to Ensembl Protein Viewer:ENSMUSP00000029270.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000029270Re-query CCDS DB by Protein ID:ENSMUSP00000029270
Original member Current member NCBI NM_009828.3 NP_033958.2 Accepted alive Link to Nucleotide Sequence:NM_009828.3Link to Protein Sequence:NP_033958.2Re-query CCDS DB by Nucleotide ID:NM_009828Re-query CCDS DB by Protein ID:NP_033958Link to BLAST:NP_033958.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033958.2 422 P51943 422 100% 0 0

Chromosomal Locations for CCDS 17313.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 36566234 36566282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 36566541 36566674 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 36567000 36567113 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 36567724 36567931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 36568588 36568811 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 36568980 36569089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 36570736 36570979 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 36571638 36571823 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1269 nt):
ATGCCGGGCACCTCGAGGCATTCGGGTCGCGATGCGGGCTCAGCCCTGCTCTCGCTGCATCAGGAAGACC
AA
GAGAATGTCAACCCCGAAAAACTGGCGCCAGCCCAGCAGCCGCGGGCGCAGGCGGTGCTGAAGGCCGG
G
AACGTGCGTGGACCCGCGCCGCAGCAGAAGCTCAAGACTCGACGGGTTGCTCCTCTTAAGGACCTTCCT
ATA
AACGATGAGCATGTCACTGCTGGTCCTTCATGGAAAGCAGTCAGTAAACAGCCTGCCTTCACCATTC
AT
GTGGATGAAGCAGAAGAGACTCAGAAGAGGCCAGCTGAGCTTAAAGAAACAGAGTGTGAAGATGCCCT
G
GCTTTTAATGCAGCTGTCTCTTTACCCGGAGCAAGAAAACCACTGACACCTCTTGACTATCCAATGGAT
GGC
AGTTTTGAATCACCACATGCTATGGATATGTCTATTGTCTTAGAAGACAAGCCAGTGAACGTTAATG
AA
GTACCTGACTATCAAGAAGACATTCACACGTACCTTAGGGAAATGGAGGTTAAATGTAAACCTAAAGT
G
GGTTACATGAAGAGGCAGCCAGACATCACTAACAGCATGAGGGCCATCCTTGTGGACTGGCTGGTTGAG
GTG
GGAGAAGAATATAAACTACAGAATGAGACCCTGCATTTGGCTGTGAACTACATTGATAGATTCCTCT
CC
TCCATGTCTGTGTTAAGAGGGAAGCTTCAGCTTGTAGGCACGGCTGCTATGCTGCTAGCTTCGAAGTT
T
GAAGAAATATACCCCCCAGAAGTAGCAGAGTTTGTGTATATTACAGACGATACCTATTCCAAGAAGCAG
GTT
CTGAGAATGGAGCACCTAGTATTGAAAGTCCTTGCTTTTGACTTGGCTGCACCAACAGTAAATCAGT
TC
CTTACCCAGTACTTCCTGCACCTGCAGCCTGCAAACTGTAAGGTTGAAAGCTTAGCAATGTTTTTGGG
A
GAACTGAGTTTGATAGATGCTGACCCGTACCTTAAGTACCTGCCTTCACTCATTGCTGGAGCTGCCTTC
CAC
TTGGCTCTCTACACAGTCACAGGACAGAGCTGGCCTGAGTCATTGGCACAACAGACTGGATATACCC
TG
GAGAGTCTTAAGCCTTGTCTTGTGGACCTTCACCAGACCTACCTCAAAGCGCCACAACATGCCCAACA
G
TCAATACGGGAAAAGTACAAGCATTCAAAATATCACAGTGTTTCTCTTCTCAACCCACCAGAGACACTA
AGT
GTGTGA


Translation (422 aa):
MPGTSRHSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKTRRVAPLKDLP
I
NDEHVTAGPSWKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFNAAVSLPGARKPLTPLDYPMD
G
SF
ESPHAMDMSIVLEDKPVNVNEVPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVE
V
GEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLA
SKFEEIYPPEVAEFVYITDDTYSKKQ
V
LRMEHLVLKVLAFDLAAPTVNQFLTQYFLHLQPANCKVESLAM
FLGELSLIDADPYLKYLPSLIAGAAF
H
LALYTVTGQSW
PESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETL
S
V




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser