NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS17104.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17104.1 Public Mus musculus 2 Peds1 23 108 98 CCDS HistoryNCBI Gene:407243Re-query CCDS DB by CCDS ID:17104.1Re-query CCDS DB by GeneID:407243See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 17104.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000006587.6 ENSMUSP00000006587.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000006587.6Link to Ensembl Protein Viewer:ENSMUSP00000006587.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000006587Re-query CCDS DB by Protein ID:ENSMUSP00000006587
Original member Current member NCBI NM_145538.2 NP_663513.1 Accepted alive Link to Nucleotide Sequence:NM_145538.2Link to Protein Sequence:NP_663513.1Re-query CCDS DB by Nucleotide ID:NM_145538Re-query CCDS DB by Protein ID:NP_663513Link to BLAST:NP_663513.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_663513.1 271 Q99LQ7 271 100% 0 0

Chromosomal Locations for CCDS 17104.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 167644061 167644182 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 167644764 167644976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 167646032 167646176 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 167646968 167647059 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 167654608 167654727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 167661373 167661496 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (816 nt):
ATGGCGGGCGCCGAGGACGCGCCGGGCCGGCAGCCGGAGCTGGACGAGGACGAGACGGCGGAGGGCCGGC
GC
TGGGGCGCACAGCACGCGGGAGCCCGTGAGCTGGCGGCGCTTTACTCGCCAGGCAAGCGCTTCCAGGA
G
TGGTGTTCCGTGATCCTCTGTTTCAGTCTCATCGCCCACAACTTGGTCCACCTCCTGCTGCTGGCCCGC
TGG
GAGCACACACCCCTCGTGATCCTGGGTGTCGTTGCAGGGGCTCTCGTCGCTGACTTCCTGTCCGGCC
TG
GTACATTGGGGTGCTGATACATGGGGTTCTGTGGACCTGCCCATTGTCGGGAAGGCCTTCATCCGGCC
A
TTCCGGGAGCACCACATTGACCCCACAGCCATCACAAGGCATGACTTCATCGAGACCAATGGGGACAAC
TGC
CTGGTCACGCTGCTGCCACTGCTAAACATGGCCTACAAGTTCCGGACCCAGAGCCCAGAGACCCTGG
AG
CAGCTGTACCCTTGGGAATGCTTCGTCTTCTGTCTGACCATCTTTGGCACCTTCACCAACCAGATCCA
C
AAGTGGTCACACACATACTTAGGGCTGCCATACTGGGTCACCGTCCTGCAGGACTGGCACGTGATCCTA
CCA
CGGAAACACCATCGCATCCACCACGTGGCGCCCCACGAAACATACTTCTGTATCACCACAGGCTGGC
TC
AACTACCCCCTAGAGGTTATAGGCTTCTGGCGGCGCCTGGAGGATCTCATCCAAGGCCTGACGGGTGA
G
AAGCCGAGAGCGGACGACATGAAATGGGCACAGAAGATCAAGTAG


Translation (271 aa):
MAGAEDAPGRQPELDEDETAEGRRWGAQHAGARELAALYSPGKRFQEWCSVILCFSLIAHNLVHLLLLAR
W
EHTPLVILGV
VAGALVADFLSGLVHWGADTWGSVDLPIVGKAFIRPFREHHIDPTAITRHDFIETNGDN
C
LVTLLPLLNMAYKFRTQSP
ETLEQLYPWECFVFCLTIFGTFTNQIHKWSHTYLGLPYWVTVLQDWHVIL
P
RKHHRIHHVAPHETYFCITT
GWLNYPLEVIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser