NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS16976.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16976.1 Public Mus musculus 2 Ghrh 23 108 98 CCDS HistoryNCBI Gene:14601Re-query CCDS DB by CCDS ID:16976.1Re-query CCDS DB by GeneID:14601See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16976.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000029172.1 ENSMUSP00000029172.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029172.1Link to Ensembl Protein Viewer:ENSMUSP00000029172.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000029172Re-query CCDS DB by Protein ID:ENSMUSP00000029172
Original member Current member EBI,WTSI ENSMUST00000109536.7 ENSMUSP00000105162.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109536.7Link to Ensembl Protein Viewer:ENSMUSP00000105162.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000109536Re-query CCDS DB by Protein ID:ENSMUSP00000105162
Original member Current member NCBI NM_001329683.1 NP_001316612.1 Accepted alive Link to Nucleotide Sequence:NM_001329683.1Link to Protein Sequence:NP_001316612.1Re-query CCDS DB by Nucleotide ID:NM_001329683Re-query CCDS DB by Protein ID:NP_001316612Link to BLAST:NP_001316612.1
Original member Current member NCBI NM_010285.3 NP_034415.1 Accepted alive Link to Nucleotide Sequence:NM_010285.3Link to Protein Sequence:NP_034415.1Re-query CCDS DB by Nucleotide ID:NM_010285Re-query CCDS DB by Protein ID:NP_034415Link to BLAST:NP_034415.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001316612.1 103 P16043 103 100% 0 0
NP_034415.1 103 P16043 103 100% 0 0

Chromosomal Locations for CCDS 16976.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 157329597 157329635 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 157331779 157331869 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 157333378 157333479 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 157333693 157333772 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (312 nt):
ATGCTGCTCTGGGTGCTCTTTGTGATCCTCATCCTCACCAGTGGCTCCCACTGCTCACTGCCCCCCTCAC
CT
CCCTTCAGGATGCAGCGACACGTAGATGCCATCTTCACCACCAACTACAGGAAACTCCTGAGCCAGCT
G
TATGCCCGGAAAGTGATCCAGGACATCATGAACAAGCAAGGGGAGAGGATCCAGGAACAAAGGGCCAGG
CTC
AGCCGCCAGGAAGACAGCATGTGGACAGAGGACAAGCAGATGACCCTGGAGAGCATCTTGCAGGGAT
TC
CCAAGGATGAAGCCTTCAGCGGACGCTTGA


Translation (103 aa):
MLLWVLFVILILTSGSHCSLPPSPPFRMQRHVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRAR
L
SRQEDSMWTEDKQMTLESIL
QGFPRMKPSADA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser