NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16696.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16696.1 Public Mus musculus 2 Ciao1 21 106 86 CCDS HistoryNCBI Gene:26371Re-query CCDS DB by CCDS ID:16696.1Re-query CCDS DB by GeneID:26371See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16696.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000003759 ENSMUSP00000003759 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000003759Link to Ensembl Protein Viewer:ENSMUSP00000003759Re-query CCDS DB by Nucleotide ID:ENSMUST00000003759Re-query CCDS DB by Protein ID:ENSMUSP00000003759
Original member Current member EBI,WTSI OTTMUST00000038151 OTTMUSP00000017107 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000038151Link to Vega Protein Viewer:OTTMUSP00000017107Re-query CCDS DB by Nucleotide ID:OTTMUST00000038151Re-query CCDS DB by Protein ID:OTTMUSP00000017107
Original member Current member NCBI NM_025296.4 NP_079572.2 Accepted alive Link to Nucleotide Sequence:NM_025296.4Link to Protein Sequence:NP_079572.2Re-query CCDS DB by Nucleotide ID:NM_025296Re-query CCDS DB by Protein ID:NP_079572Link to BLAST:NP_079572.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079572.2 339 Q99KN2 339 100% 0 0

Chromosomal Locations for CCDS 16696.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 127242797 127243037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 127244913 127245000 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 127245723 127245924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 127246413 127246501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 127246602 127246713 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 127247010 127247158 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 127247482 127247620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1020 nt):
ATGAAAGATTCTCTGGTACTGCAGAGCCGCGTCCCGGCGCACCCGGATTCCCGCTGCTGGTTCCTGGCCT
GG
AACCCCTCGGGGACCCTGTTGGCTTCCTGCGGAGGCGACCGTAAAATTCGCATCTGGGGCACCGAGGG
T
GACAGCTGGATTTGCAAGTCTGTCCTTTCTGAAGGCCATCAGCGCACCGTTAGGAAAGTGGCCTGGTCC
CCG
TGTGGAAATTACCTGGCATCTGCCAGCTTTGATGCCACCACTTGTATTTGGAAGAAGAACCAGGATG
AC
TTTGAGTGTGTGACCACTCTTGAGGGCCATGAAAATGAGGTCAAGTCAGTGGCTTGGGCCCCATCTGG
C
AACCTCTTGGCTACCTGCAGCAGAGATAAGAGCGTGTGGGTCTGGGAAGTTGATGAAGAGGATGAGTAT
GAG
TGTGTCAGTGTCCTCAGCTCTCATACGCAGGACGTTAAGCACGTGGTTTGGCACCCGAGCCAGGAGC
TT
TTAGCTTCTGCTAGCTATGATGACACAGTGAAGCTATACCAGGAAGAAGGGGATGACTGGGTCTGCTG
T
GCCACCCTCGAAGGTCATGAGTCCACTGTTTGGAGCATAGCCTTTGATCCCAGCGGCCAGCGGCTGGCA
TCT
TGCAGTGATGACCGAACTGTACGCATCTGGCGCCAGTATCTACCGGGCAATGAACAAGGGGTGGCAT
GC
AGTGGCTCTGACCCCAGCTGGAAATGTATCTGCACTTTGTCGGGCTTCCACACCAGGACCATTTACGA
C
GTTGCTTGGTGTCAGCTGACAGGGGCCTTGGCTACAGCTTGTGGAGATGATGCCATCCGAGTGTTTGAG
GAA
GACCCAGGCTCAGACCCACAGCAGCCCACCTTCTCTCTGACAGCCCATCTTCGTCAGGCCCATTCCC
AG
GATGTCAACTGTGTGGCTTGGAATCCCAAGGAGCCAGGGCTCCTGGCCTCTTGTAGTGATGATGGGGA
G
GTAGCCTTCTGGGAGTATCACCAGCCTGCAGGTCTCTGA


Translation (339 aa):
MKDSLVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSWICKSVLSEGHQRTVRKVAWS
P
CGNYLASASFDATTCIWKKNQDDFE
CVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEY
E
CVSVLSSHTQDVKHVVWHPSQE
LLASASYDDTVKLYQEEGDDWVCCATLEGHESTVWSIAFDPSGQRLA
S
CSDDRTVRIWRQYLPGNEQ
GVACSGSDPSWKCICTLSGFHTRTIYDVAWCQLTGALATACGDDAIRVFE
E
DPGSDPQQPTFSLTAHLRQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWEYHQPAGL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser