NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS16692.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16692.1 Public Mus musculus 2 Blvra 23 108 98 CCDS HistoryNCBI Gene:109778Re-query CCDS DB by CCDS ID:16692.1Re-query CCDS DB by GeneID:109778See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16692.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000002064.14 ENSMUSP00000002064.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000002064.14Link to Ensembl Protein Viewer:ENSMUSP00000002064.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000002064Re-query CCDS DB by Protein ID:ENSMUSP00000002064
Original member Current member NCBI NM_026678.4 NP_080954.4 Accepted alive Link to Nucleotide Sequence:NM_026678.4Link to Protein Sequence:NP_080954.4Re-query CCDS DB by Nucleotide ID:NM_026678Re-query CCDS DB by Protein ID:NP_080954Link to BLAST:NP_080954.4

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080954.4 295 Q9CY64 295 100% 0 0

Chromosomal Locations for CCDS 16692.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 127080647 127080658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 127082932 127083050 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 127085963 127086082 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 127086845 127086942 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 127092039 127092146 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 127095086 127095257 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 127096735 127096993 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (888 nt):
ATGAGTACTGAGCCAAAGAGGAAATTTGGTGTGGTAGTGGTTGGTGTTGGCAGAGCTGGCTCTGTGAGGA
TA
AGGGACTTGAAGGATCCACACTCTTCAGCATTCCTAAACCTGATTGGATATGTGTCCAGACGAGAACT
T
GGGAGCCTTGATAATGTACGGCAGATTTCTTTGGAAGATGCTCTCCGCAGCCAAGAGGTTGATGTCGCC
TAT
ATTTGCACTGAGAGTTCCAGCCACGAAGACTATATAAGGCAGTTTCTTCAGGCTGGCAAGCATGTCC
TC
GTGGAATACCCCATGGCATTGTCATTTGCGGCAGCGCAGGAGCTGTGGGAGCTGGCTGCACAGAAAGG
G
AGAGTCCTGCATGAGGAGCACATCGAACTCTTGATGGAAGAGTTCGAATTCCTGAAAAGAGAAGTGGCC
GGG
AAGGAGCTGCTAAAAGGATCTCTTCGCTTCACAGCCAGCCCCCTGGAAGAAGAGAAATTTGGCTTCC
CT
GCGTTCAGTGGCATTTCTCGCCTGACCTGGCTGGTCTCCCTCTTTGGGGAGCTTTCTCTTATTTCTGC
C
ACCATGGAAAACCGAAAAGAAGATCAATATATGAAAATGACCGTGCAGCTCGAGACCCAGAACAAAAGT
CCA
TTATCATGGATTGAAGAGAAAGGGCCTGGCTTAAAAAGGAACAGACATATAAGCATCCACTTCAAAT
CT
GGGTCCTTGGAGGAAGTGCCAAATGTAGGAGTCAATAAGAACATTTTCCTGAAAGATCAGGATATATT
T
ATCCAGAAGCTCTTGGGCCAGGTCTCTGCAGAGGACCTGGCTGCTGAGAAGAAGCGCATCCTGCATTGC
CTG
GAGCTGGCCAGCGACATCCAGAGGCTGTGCCACCGGAAGCAGTGA


Translation (295 aa):
MSTEPKRKFGVVVVGVGRAGSVRIRDLKDPHSSAFLNLIGYVSRRELGSLDNVRQISLEDALRSQEVDVA
Y
ICTESSSHEDYI
RQFLQAGKHVLVEYPMALSFAAAQELWELAAQKGRVLHEEHIELLMEEFEFLKREVA
G
KELLKGSLRFT
ASPLEEEKFGFPAFSGISRLTWLVSLFGELSLISATMENRKEDQYMKMTVQLETQNKS
P
LSWIEEKGPGLKRNRHISIHFKSGSLEEVPNVGVNKNIFLKDQDIFIQKLLGQVSAEDLAAEKKRILHC
L
ELASDIQRLCHRKQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser