NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS16551.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16551.1 Public Mus musculus 2 Slc12a6 23 108 98 CCDS HistoryNCBI Gene:107723Re-query CCDS DB by CCDS ID:16551.1Re-query CCDS DB by GeneID:107723See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16551.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000028549.13 ENSMUSP00000028549.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028549.13Link to Ensembl Protein Viewer:ENSMUSP00000028549.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000028549Re-query CCDS DB by Protein ID:ENSMUSP00000028549
Original member Current member NCBI NM_133649.2 NP_598410.2 Accepted alive Link to Nucleotide Sequence:NM_133649.2Link to Protein Sequence:NP_598410.2Re-query CCDS DB by Nucleotide ID:NM_133649Re-query CCDS DB by Protein ID:NP_598410Link to BLAST:NP_598410.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_598410.2 1150 Q924N4-1 1150 100% 0 0

Chromosomal Locations for CCDS 16551.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 112266822 112267092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112316241 112316285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112333383 112333477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112334369 112334500 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112335776 112335922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112337358 112337412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112337859 112337989 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112339246 112339487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112341831 112342045 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112343829 112343987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112344139 112344237 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112344488 112344545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112346899 112347073 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112347317 112347435 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112349276 112349374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112351279 112351398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112352444 112352548 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112352892 112353060 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112354174 112354369 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112354975 112355144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112356460 112356591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112357484 112357591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112357768 112357952 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112358506 112358639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 112360416 112360507 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3453 nt):
ATGCATCCACCAGAAGCCACCACCAAGATGTCCTCAGTTCGGTTCATGGTGACACCAACTAAGATTGATG
AC
ATTCCAGGTTTGTCAGACACCAGCCCGGACCTCAGCTCTCGGTCTAGTTCTCGAGTAAGATTTAGCTC
C
CGAGAAAGTGTGCCAGAAACAAGCCGTAGTGAGCCTATGAGCGAACTGTCTGGGGCTACTACTTCTCTG
GCA
ACTGTTGCCCTAGATCCTTCCAGTGACCGGACTTCTAATCCCCAGGATGTTACGGAGGACCCGAGTC
AG
AACTCCATCACAGGGGAGCACAGCCAGCTGTTAGATGACGGCCATAAAAAAGCCCGAAATGCTTATCT
C
AATAATTCCAACTATGAAGAAGGAGACGAATATTTTGATAAAAATTTGGCACTCTTTGAGGAAGAAATG
GAC
ACCAGACCAAAGGTGTCTTCTCTCCTCAACCGCATGGCCAACTATACAAATCTGACACAAGGAGCAA
AG
GAACATGAAGAGGCAGAGAACATCACTGAAGGGAAAAAGAAGCCTACCAAGAGCCCCCAAATGGGTAC
T
TTCATGGGTGTCTACCTCCCATGTCTACAGAACATCTTTGGAGTGATCCTCTTCCTGCGTCTTACCTGG
GTA
GTGGGAACAGCTGGAATCCTTCAGGCCTTTGCAATTGTCCTCATCTGCTGCTGCTGTACAATGTTAA
CT
GCCATCTCCATGAGCGCCATCGCCACTAACGGAGTGGTGCCAGCTGGGGGCTCATACTTCATGATTTC
C
AGAGCCCTGGGCCCAGAGTTTGGCGGGGCTGTAGGCCTCTGCTTTTATCTTGGCACCACATTTGCAGCA
GCC
ATGTATATTCTTGGTGCCATTGAAATCTTTCTGGTATACATTGTCCCCCGAGCTGCCATCTTTCGGA
GT
GACGATGCACTCAAGGAGTCAGCAGCTATGCTGAACAACATGCGCGTCTATGGTACAGCCTTCTTGGT
C
CTCATGGTCTTGGTGGTATTCATCGGCGTACGCTATGTGAATAAGTTTGCCTCACTCTTCCTGGCCTGT
GTA
ATTGTGTCGATCTTGGCTATCTATGCTGGTGCCATCAAGTCTTCCTTTGCTCCACCACACTTCCCGG
TC
TGTATGCTGGGCAACCGTACCCTGTCATCAAGACACCTTGACATTTGCTCTAAGACCAAGGAGGTTGA
C
AACATGACAGTACCATCAAAGTTATGGGGATTCTTCTGCAACTCGAGTCAGTTCTTTAATGCCACCTGT
GAT
GAGTACTTTGTTCACAATAACGTCATCTCAATCCAAGGCATTCCAGGGTTGGCTAGTGGTATCATTA
CT
GAAAATCTTTGGAGTAATTATTTACCAAAGGGTGAGATAATTGAAAAGCCATCAGCCAAGTCATCTGA
T
GTCTTAGGCAACTTAAACCATGAATATGTTCTTGCTGATATCACCACCTCCTTCACTCTGCTGGTGGGG
ATC
TTCTTTCCCTCGGTCACAGGTATCATGGCTGGGTCAAACAGATCTGGAGATCTGAAAGATGCCCAGA
AG
TCTATTCCCATTGGGACCATCCTTGCCATCCTGACCACATCCTTTGTGTATTTAAGCAATGTTGTCCT
T
TTTGGTGCATGTATTGAAGGAGTCGTTCTCAGAGACAAATTTGGGGATGCTGTAAAAGGGAATTTGGTT
GTA
GGCACCTTATCCTGGCCATCCCCGTGGGTGATCGTTATTGGCTCCTTCTTTTCAACATGTGGGGCTG
GG
CTGCAGAGCCTCACAGGTGCGCCTCGGCTGCTGCAGGCTATCGCCAAGGATAACATCATACCTTTCCT
T
AGGGTTTTTGGTCACAGCAAAGCTAATGGGGAACCTACCTGGGCTTTACTTCTAACTGCTGCCATAGCA
GAG
CTGGGAATTCTCATCGCCTCCCTGGATCTCGTGGCCCCAATTCTTTCCATGTTTTTTCTCATGTGTT
AC
CTCTTTGTGAACTTGGCTTGTGCCTTGCAAACATTGCTGCGAACCCCCAACTGGAGGCCTCGATTCCG
C
TATTATCACTGGGCCCTCTCTTTCATGGGAATGAGTATCTGTCTAGCTCTGATGTTCATTTCTTCTTGG
TAT
TATGCCATTGTAGCTATGGTAATAGCTGGCATGATCTACAAGTACATTGAATATCAAGGGGCTGAGA
AA
GAATGGGGGGATGGTATCCGTGGGCTGTCGCTCAGTGCAGCCCGCTTCGCTTTGCTCCGTCTAGAGGA
A
GGACCTCCTCACACTAAAAACTGGAGGCCTCAGCTGCTCGTCCTACTGAAGCTGGATGAAGATTTACAC
GTC
AAGCACCCTCGCCTCCTCACCTTTGCCTCCCAGCTCAAGGCAGGAAAGGGACTCACGATTGTGGGCT
CT
GTCATCGTGGGGAACTTCTTGGAGAACTATGGTGACGCGCTCGCGGCAGAGCAGACCATTAAGCACCT
A
ATGGAGGCAGAAAAGGTAAAAGGATTCTGCCAATTGGTGGTGGCTGCCAAGCTGAAAGAGGGCATTTCA
CAC
CTCATCCAGTCCTGTGGCCTCGGAGGCATGAAACACAACACAGTGGTGATGGGCTGGCCCAATGGCT
GG
CGTCAGAGTGAAGATGCTCGCGCTTGGAAGACTTTCATTGGCACAGTACGAGTGACAACTGCTGCCCA
T
CTAGCCCTGCTGGTGGCTAAAAATGTCTCCTTCTTTCCCAGCAATGTGGAGCAGTTTTCTGAGGGCAAC
ATT
GATGTGTGGTGGATTGTGCATGATGGGGGCATGCTCATGCTATTACCGTTCCTGCTGAAACAGCACA
AG
GTTTGGCGGAAATGCAGCATACGGATCTTCACAGTAGCCCAACTAGAAGACAACAGTATCCAGATGAA
G
AAGGATCTGGCCACCTTTCTGTACCACCTGCGCATTGAGGCAGAAGTGGAAGTGGTGGAGATGCACGAC
AGT
GACATATCTGCCTATACATATGAGCGCACCCTGATGATGGAGCAGAGGTCCCAGATGCTTCGGCATA
TG
CGGCTGTCCAAAACAGAGCGAGACAGGGAGGCACAGCTGGTGAAAGATCGAAACTCAATGCTACGCTT
G
ACCAGCATTGGCTCTGATGAGGACGAAGAGACAGAAACGTACCAGGAGAAGGTGCACATGACTTGGACC
AAG
GATAAATACATGGCATCCCGGGGGCAAAAGGTCAAGTCAATGGAAGGATTCCAGGACCTACTTAATA
TG
CGTCCGGACCAGTCCAACGTGAGACGGATGCATACAGCAGTGAAGCTCAATGAAGTTATAGTCAACAA
G
TCTCATGAAGCAAAGCTGGTTTTGTTGAATATGCCAGGACCACCCCGGAACCCTGAAGGTGATGAAAAC
T
AC
ATGGAATTTCTAGAAGTGCTCACTGAGGGATTAGAACGAGTCCTTCTTGTCCGGGGTGGTGGCAGTG
AG
GTCATCACCATTTACTCATAA


Translation (1150 aa):
MHPPEATTKMSSVRFMVTPTKIDDIPGLSDTSPDLSSRSSSRVRFSSRESVPETSRSEPMSELSGATTSL
A
TVALDPSSDRTSNPQDVTE
DPSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEM
D
TRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTK
SPQMGTFMGVYLPCLQNIFGVILFLRLTW
V
VGTAGILQAFAIVLICCCC
TMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAA
A
MYILGAIEIFL
VYIVPRAAIFRSDDALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLAC
V
IVSILAIYAGAIKSSFAPPHF
PVCMLGNRTLSSRHLDICSKTKEVDNMTVPSKLWGFFCNSSQFFNATC
D
EYFVHNNVISIQGIPGLASGIIT
ENLWSNYLPKGEIIEKPSAKSSDVLGNLNHEYVLADITTSFTLLVG
I
FFPSVT
GIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLV
V
GTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLR
VFGHSKANGEPTWALLLTAAIA
E
LGILIASLDLVAPILS
MFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSW
Y
YAIVAMVIAGMIYKYIEYQ
GAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDEDLH
V
KHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYGDALAAEQ
TIKHLMEAEKVKGFCQLVVAAKLKEGIS
H
LIQSCGLGGMKHNTVVMGWPNGWRQSEDARAWKTFI
GTVRVTTAAHLALLVAKNVSFFPSNVEQFSEGN
I
DVWWIVHDGGMLMLLPFLLKQHK
VWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMHD
S
DISAYTYERTLMMEQRSQMLRHMRLSKTERDRE
AQLVKDRNSMLRLTSIGSDEDEETETYQEKVHMTWT
K
DKYMASRGQKVKSMEGFQDLLNMR
PDQSNVRRMHTAVKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDEN
Y
MEFLEVLTEGLERVLLVRGGGSEVITIYS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser