NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16461.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16461.1 Public Mus musculus 2 B230118H07Rik 21 106 86 CCDS HistoryNCBI Gene:68170Re-query CCDS DB by CCDS ID:16461.1Re-query CCDS DB by GeneID:68170See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16461.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000090513 ENSMUSP00000087999 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000090513Link to Ensembl Protein Viewer:ENSMUSP00000087999Re-query CCDS DB by Nucleotide ID:ENSMUST00000090513Re-query CCDS DB by Protein ID:ENSMUSP00000087999
Original member Current member EBI,WTSI ENSMUST00000111231 ENSMUSP00000106862 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111231Link to Ensembl Protein Viewer:ENSMUSP00000106862Re-query CCDS DB by Nucleotide ID:ENSMUST00000111231Re-query CCDS DB by Protein ID:ENSMUSP00000106862
Original member Current member EBI,WTSI ENSMUST00000160037 ENSMUSP00000123987 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000160037Link to Ensembl Protein Viewer:ENSMUSP00000123987Re-query CCDS DB by Nucleotide ID:ENSMUST00000160037Re-query CCDS DB by Protein ID:ENSMUSP00000123987
Original member Current member EBI,WTSI ENSMUST00000160722 ENSMUSP00000124783 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000160722Link to Ensembl Protein Viewer:ENSMUSP00000124783Re-query CCDS DB by Nucleotide ID:ENSMUST00000160722Re-query CCDS DB by Protein ID:ENSMUSP00000124783
Original member Current member EBI,WTSI OTTMUST00000034573 OTTMUSP00000015473 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000034573Link to Vega Protein Viewer:OTTMUSP00000015473Re-query CCDS DB by Nucleotide ID:OTTMUST00000034573Re-query CCDS DB by Protein ID:OTTMUSP00000015473
Original member Current member EBI,WTSI OTTMUST00000034574 OTTMUSP00000015474 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000034574Link to Vega Protein Viewer:OTTMUSP00000015474Re-query CCDS DB by Nucleotide ID:OTTMUST00000034574Re-query CCDS DB by Protein ID:OTTMUSP00000015474
Original member Current member EBI,WTSI OTTMUST00000086759 OTTMUSP00000047001 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000086759Link to Vega Protein Viewer:OTTMUSP00000047001Re-query CCDS DB by Nucleotide ID:OTTMUST00000086759Re-query CCDS DB by Protein ID:OTTMUSP00000047001
Original member Current member EBI,WTSI OTTMUST00000086760 OTTMUSP00000047002 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000086760Link to Vega Protein Viewer:OTTMUSP00000047002Re-query CCDS DB by Nucleotide ID:OTTMUST00000086760Re-query CCDS DB by Protein ID:OTTMUSP00000047002
Original member NCBI NM_026592.3 NP_080868.1 Updated not alive Link to Nucleotide Sequence:NM_026592.3Link to Protein Sequence:NP_080868.1Re-query CCDS DB by Nucleotide ID:NM_026592Re-query CCDS DB by Protein ID:NP_080868
Current member NCBI NM_026592.4 NP_080868.1 Accepted alive Link to Nucleotide Sequence:NM_026592.4Link to Protein Sequence:NP_080868.1Re-query CCDS DB by Nucleotide ID:NM_026592Re-query CCDS DB by Protein ID:NP_080868Link to BLAST:NP_080868.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080868.1 244 Q9CQI4 244 100% 0 0

Chromosomal Locations for CCDS 16461.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 101562190 101562354 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 101576012 101576151 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 101583521 101583587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 101585244 101585315 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 101586312 101586469 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 101610524 101610656 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (735 nt):
ATGCTTGCTCAAATACCGAGGCCAGAGATAATGGATGAAGATCAGTTAATGAAAGAAGTCTTGGATAAGT
TT
GTCAACTGCCATGAGCAAACCTATGAAGAATTTCTGAGCACTTTCACTCATCTTTCAAAAGAGGATAA
T
GTGGCCAAATGGGGAGCACATGGAACTGATTCATCAGAAAATATATTTTCTACTGTAAAATGGAATCAT
AAA
ACTGAATCAAATGGTCGTCATTTTAGAAATACATCCATCTTTCTTCACACTTCATCGGAACACTCAG
AA
GAGGACCAGATTGTGATTGATGAAGGCCACAAAGTTGGGAGTTCCTTTCAAGGTGATATGACCCGGGC
T
GGAAAGGTGAAGGTAGACAACTTCCTAGACTTAGAAGATGTGGACATGGAGGAAGAGAGTAAGCCCCAG
ATG
AACAAGGATTGCCTGCTACTTCCAGGTGAGGTGGAACAGGATATAAGCACCAGCGTTCCATCTTATG
AT
CCTTCTGTGGACCTACCGCTCACCTCTGAGGTGAGGCCAAAGCCTGCTGTGGGAAGGACTCAGAAACA
A
ACCGAAGAGATACTTGGAGATGAAGTTCAGCCCTTCTTTCTCGATGAAGAATTTGATTATGACAATGTG
ACT
CTCACTCCTAAGTTTACTGCTGGAGAGATAGCAACCATCCAAGAGCTATCTAAGCAAAAGAGAGTGG
GT
TCCGGTACAAACGTGTGCGAACTCCATGACTGA


Translation (244 aa):
MLAQIPRPEIMDEDQLMKEVLDKFVNCHEQTYEEFLSTFTHLSKEDNVAKWGAHGTDSSENIFSTVKWNH
K
TESNGRHFRNTSIFLHTSSEHSEEDQ
IVIDEGHKVGSSFQGDMTRAGKVKVDNFLDLEDVDMEEESKPQ
M
NK
DCLLLPGEVEQDISTSVPSYDPSVDLPLTSEVRPKPAVGRTQKQTEEILGDEVQPFFLDEEFDYDNV
T
LTPKFTAGEIATIQELSKQKRVGSGTNVCELHD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser