NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS16427.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16427.1 Public Mus musculus 2 Acp2 23 108 98 CCDS HistoryNCBI Gene:11432Re-query CCDS DB by CCDS ID:16427.1Re-query CCDS DB by GeneID:11432See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16427.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000002172.13 ENSMUSP00000002172.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000002172.13Link to Ensembl Protein Viewer:ENSMUSP00000002172.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000002172Re-query CCDS DB by Protein ID:ENSMUSP00000002172
Original member Current member EBI ENSMUST00000239169.1 ENSMUSP00000159053.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000239169.1Link to Ensembl Protein Viewer:ENSMUSP00000159053.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000239169Re-query CCDS DB by Protein ID:ENSMUSP00000159053
Original member Current member NCBI NM_007387.2 NP_031413.1 Accepted alive Link to Nucleotide Sequence:NM_007387.2Link to Protein Sequence:NP_031413.1Re-query CCDS DB by Nucleotide ID:NM_007387Re-query CCDS DB by Protein ID:NP_031413Link to BLAST:NP_031413.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031413.1 423 P24638 423 100% 0 0

Chromosomal Locations for CCDS 16427.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 91202935 91203048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 91203601 91203696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 91204240 91204326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 91205756 91205908 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 91206010 91206108 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 91206188 91206277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 91206717 91206849 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 91207817 91207899 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 91208040 91208146 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 91208261 91208436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 91210607 91210740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1272 nt):
ATGGCCGGCAGACAGACTGGTTGGAGCCAGGCGGCTCTTCTCCAGTTCCTTCTTGGCATGTGCCTAACGG
TG
ATGCCACCCATACAGGCCCGGAGTCTACGCTTTGTTACCTTGCTGTATCGACATGGAGATCGGTCACC
A
GTGAAGACATATCCCAAGGACCCCTATCAGGAAGAGAAATGGCCCCAGGGATTTGGTCAGCTAACCAAG
GAA
GGGATGCTACAGCACTGGGAGCTGGGCCAGGCCCTGCGGCAACGCTACCATGGCTTTCTGAACACCT
CT
TACCACAGGCAAGAGGTTTATGTGCGAAGCACAGACTTCGATCGTACTCTCATGAGTGCTGAGGCCAA
C
CTGGCTGGACTCTTCCCTCCCAATGAAGTTCAGCACTTCAACCCTAACATTTCATGGCAGCCTATCCCT
GTT
CACACTGTGCCCATCACTGAAGACAGGTTGCTGAAGTTTCCTTTGGGTCCATGTCCCCGTTATGAGC
AG
CTGCAGAATGAGACTCGGCAGACACCAGAGTATCAGAACAGAAGTATTCAGAATGCACAATTTCTGAA
C
ATGGTGGCCAACGAGACAGGGCTTACAAACGTGACCCTAGAGACCATCTGGAATGTGTATGACACACTC
TTT
TGTGAGCAAACCCATGGGCTGCTTCTGCCGCCCTGGGCCTCACCCCAAACCGTGCAGCGTCTGAGCC
AG
CTAAAGGACTTCAGCTTCCTCTTCCTCTTCGGGATCCACGAGCAAGTACAGAAGGCCCGGCTTCAGGG
G
GGAGTTCTGCTGGCTCAGATATTGAAGAACCTGACCCTAATGGCAACTACCTCTCAATTCCCTAAGCTT
CTG
GTTTATTCCGCGCATGACACTACCCTGGTTGCTCTGCAAATGGCATTGAATGTCTACAATGGGAAGC
AA
GCTCCCTATGCTTCCTGCCACATATTTGAACTGTACCAGGAAGATAATGGGAATTTCTCAGTCGAGAT
G
TACTTTCGGAATGACAGTAAGAAGGCACCCTGGCCTCTGATCCTGCCTGGCTGTCCTCACCGTTGCCCA
CTG
CAGGATTTCCTTCGCCTCACAGAGCCTGTCATACCCAAGGACTGGCAGAAGGAGTGCCAGCTAGCAA
AT
GATACTGCAGACACAGAGGTAATTGTGGCATTGGCTGTCTGTGGCTCCATCCTCTTCCTTCTCATAGT
G
TTGCTCCTCACCATCCTCTTCCGGATGCAGGCCCAGCCTCCTGGCTACCACCATGTTGCAGACAGGGAA
GAC
CATGCTTGA


Translation (423 aa):
MAGRQTGWSQAALLQFLLGMCLTVMPPIQARSLRFVTLLYRHGDRSPVKTYPKDPYQEEKWPQGFGQLTK
E
GMLQHWELGQALRQRYHGFLNTSYHRQE
VYVRSTDFDRTLMSAEANLAGLFPPNEVQHFNPNISWQPIP
V
HTVPITEDR
LLKFPLGPCPRYEQLQNETRQTPEYQNRSIQNAQFLNMVANETGLTNVTLETIWNVYDTL
F
CE
QTHGLLLPPWASPQTVQRLSQLKDFSFLFLFGIHEQVQKARLQGGVLLAQILKNLTLMATTSQFPKL
L
VYSA
HDTTLVALQMALNVYNGKQAPYASCHIFELYQEDNGNFSVEMYFRNDSKKAPWPLILPGCPHRCP
L
QDFLRLTEPVIPKDWQKECQLANDTADT
EVIVALAVCGSILFLLIVLLLTILFRMQAQPPGYHHVADRE
D
HA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser