NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS16136.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16136.1 Public Mus musculus 2 Atp5g3 23 108 98 CCDS HistoryNCBI Gene:228033Re-query CCDS DB by CCDS ID:16136.1Re-query CCDS DB by GeneID:228033See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16136.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000018914.2 ENSMUSP00000018914.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000018914.2Link to Ensembl Protein Viewer:ENSMUSP00000018914.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000018914Re-query CCDS DB by Protein ID:ENSMUSP00000018914
Original member Current member EBI ENSMUST00000111996.7 ENSMUSP00000107627.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111996.7Link to Ensembl Protein Viewer:ENSMUSP00000107627.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000111996Re-query CCDS DB by Protein ID:ENSMUSP00000107627
Original member Current member NCBI NM_001301721.1 NP_001288650.1 Accepted alive Link to Nucleotide Sequence:NM_001301721.1Link to Protein Sequence:NP_001288650.1Re-query CCDS DB by Nucleotide ID:NM_001301721Re-query CCDS DB by Protein ID:NP_001288650Link to BLAST:NP_001288650.1
Original member Current member NCBI NM_175015.3 NP_778180.1 Accepted alive Link to Nucleotide Sequence:NM_175015.3Link to Protein Sequence:NP_778180.1Re-query CCDS DB by Nucleotide ID:NM_175015Re-query CCDS DB by Protein ID:NP_778180Link to BLAST:NP_778180.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001288650.1 141 P56384 141 100% 0 0
NP_778180.1 141 P56384 141 100% 0 0

Chromosomal Locations for CCDS 16136.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 73908593 73908707 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 73909184 73909377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 73909864 73909941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 73910955 73910993 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (426 nt):
ATGTTCGCCTGCGCCAAGCTCGCCCGCACCCCCGCTCTGATCCGAGCTGGATCCAGAGTTGCATATAGAC
CA
ATTTCTGCATCAGTGTTATCTCGGCCAGAGACTAGGACTGGAGAGGGCTCTACAGTTTTTAATGGGGC
C
CAGAATGGTGTGTGTCAGCTGATCCGAAGGGAGTTTCAGACCAGTGTAATCAGCAGAGACATTGATACT
GCT
GCCAAATTCATTGGTGCAGGTGCTGCAACAGTAGGAGTTGCTGGTTCTGGTGCTGGTATTGGAACAG
TC
TTTGGCAGTCTTATCATTGGTTATGCCAGAAACCCTTCACTGAAGCAGCAGCTGTTCTCATATGCTAT
C
CTGGGATTTGCCTTGTCTGAAGCTATGGGTCTCTTTTGTTTGATGGTTGCGTTCTTGATCTTGTTTGCC
ATG
TAA


Translation (141 aa):
MFACAKLARTPALIRAGSRVAYRPISASVLSRPETRTGEGSTVFNGAQNGVCQLIRREFQTSVISRDIDT
A
AKFIGAGAATVGVAGSGAGIGTVFGSLIIGYA
RNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA
M




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser