NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, October 16, 2019, starting at 8:00 a.m. EDT for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS16117.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16117.1 Public Mus musculus 2 Dlx2 21 106 86 CCDS HistoryNCBI Gene:13392Re-query CCDS DB by CCDS ID:16117.1Re-query CCDS DB by GeneID:13392See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16117.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000024159 ENSMUSP00000024159 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000024159Link to Ensembl Protein Viewer:ENSMUSP00000024159Re-query CCDS DB by Nucleotide ID:ENSMUST00000024159Re-query CCDS DB by Protein ID:ENSMUSP00000024159
Original member Current member EBI,WTSI OTTMUST00000031897 OTTMUSP00000014201 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000031897Link to Vega Protein Viewer:OTTMUSP00000014201Re-query CCDS DB by Nucleotide ID:OTTMUST00000031897Re-query CCDS DB by Protein ID:OTTMUSP00000014201
Original member Current member NCBI NM_010054.2 NP_034184.1 Accepted alive Link to Nucleotide Sequence:NM_010054.2Link to Protein Sequence:NP_034184.1Re-query CCDS DB by Nucleotide ID:NM_010054Re-query CCDS DB by Protein ID:NP_034184Link to BLAST:NP_034184.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034184.1 332 P40764 332 100% 0 0

Chromosomal Locations for CCDS 16117.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 71544520 71544924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71545384 71545568 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71545984 71546392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (999 nt):
ATGACTGGAGTCTTTGACAGTCTGGTGGCTGATATGCACTCGACCCAGATCACCGCCTCCAGCACGTACC
AC
CAGCACCAGCAGCCCCCGAGCGGTGCGGGCGCCGGCCCTGGCGGCAACAGCAACAGCAGCAGCAGCAA
C
AGCAGCCTGCACAAGCCCCAGGAGTCGCCAACCCTCCCGGTGTCCACGGCTACGGACAGCAGCTACTAC
ACC
AACCAGCAGCACCCGGCGGGCGGCGGCGGCGGGGGGGCCTCGCCCTACGCGCACATGGGCTCCTACC
AG
TACCACGCCAGCGGCCTCAACAATGTCTCCTACTCCGCCAAAAGCAGCTACGACCTGGGCTACACCGC
C
GCGTACACCTCCTACGCGCCCTACGGCACCAGTTCGTCTCCGGTCAACAACGAGCCGGACAAGGAAGAC
CTT
GAGCCTGAAATCCGAATAGTGAACGGGAAGCCAAAGAAAGTCCGGAAACCACGCACCATCTACTCCA
GT
TTCCAGCTGGCGGCCCTTCAACGACGCTTCCAGAAGACCCAGTATCTGGCCCTGCCAGAGCGAGCCGA
G
CTGGCGGCGTCCCTGGGCCTCACCCAAACTCAGGTCAAAATCTGGTTCCAGAACCGCCGATCCAAGTTC
AAG
AAGATGTGGAAAAGCGGCGAGATACCCACCGAGCAGCACCCTGGAGCCAGCGCTTCTCCTCCTTGTG
CC
TCCCCGCCGGTCTCGGCGCCAGCATCCTGGGACTTCGGCGCGCCGCAGCGGATGGCTGGCGGCGGCCC
G
GGCAGCGGAGGCGGCGGTGCGGGCAGCTCTGGCTCCAGCCCGAGCAGCGCCGCCTCGGCCTTTCTGGGA
AAC
TACCCGTGGTACCACCAGGCTTCGGGCTCCGCTTCACACCTGCAGGCCACAGCGCCACTTCTGCATC
CT
TCGCAGACTCCGCAGGCGCACCATCACCACCATCACCACCACCACGCAGGCGGGGGCGCCCCGGTGAG
C
GCGGGGACGATTTTCTAA


Translation (332 aa):
MTGVFDSLVADMHSTQITASSTYHQHQQPPSGAGAGPGGNSNSSSSNSSLHKPQESPTLPVSTATDSSYY
T
NQQHPAGGGGGGASPYAHMGSYQYHASGLNNVSYSAKSSYDLGYTAAYTSYAPYGTSSSPVNNEP
DKED
L
EPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQ
VKIWFQNRRSKF
K
KMWKSGEIPTEQHPGASASPPCASPPVSAPASWDFGAPQRMAGGGPGSGGGGAGSSGSSPSSAASAFLG
N
YPWYHQASGSASHLQATAPLLHPSQTPQAHHHHHHHHHAGGGAPVSAGTIF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser