NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, October 16, 2019, starting at 8:00 a.m. EDT for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS16057.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16057.1 Public Mus musculus 2 March7 21 106 86 CCDS HistoryNCBI Gene:57438Re-query CCDS DB by CCDS ID:16057.1Re-query CCDS DB by GeneID:57438See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 16057.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000067542 ENSMUSP00000068961 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000067542Link to Ensembl Protein Viewer:ENSMUSP00000068961Re-query CCDS DB by Nucleotide ID:ENSMUST00000067542Re-query CCDS DB by Protein ID:ENSMUSP00000068961
Original member Current member EBI,WTSI ENSMUST00000102747 ENSMUSP00000099808 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000102747Link to Ensembl Protein Viewer:ENSMUSP00000099808Re-query CCDS DB by Nucleotide ID:ENSMUST00000102747Re-query CCDS DB by Protein ID:ENSMUSP00000099808
Original member Current member EBI,WTSI ENSMUST00000102748 ENSMUSP00000099809 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000102748Link to Ensembl Protein Viewer:ENSMUSP00000099809Re-query CCDS DB by Nucleotide ID:ENSMUST00000102748Re-query CCDS DB by Protein ID:ENSMUSP00000099809
Original member Current member EBI,WTSI OTTMUST00000030731 OTTMUSP00000013781 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000030731Link to Vega Protein Viewer:OTTMUSP00000013781Re-query CCDS DB by Nucleotide ID:OTTMUST00000030731Re-query CCDS DB by Protein ID:OTTMUSP00000013781
Original member Current member EBI,WTSI OTTMUST00000030733 OTTMUSP00000013782 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000030733Link to Vega Protein Viewer:OTTMUSP00000013782Re-query CCDS DB by Nucleotide ID:OTTMUST00000030733Re-query CCDS DB by Protein ID:OTTMUSP00000013782
Original member Current member NCBI NM_020575.2 NP_065600.1 Accepted alive Link to Nucleotide Sequence:NM_020575.2Link to Protein Sequence:NP_065600.1Re-query CCDS DB by Nucleotide ID:NM_020575Re-query CCDS DB by Protein ID:NP_065600Link to BLAST:NP_065600.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_065600.1 693 Q9WV66 693 100% 0 0

Chromosomal Locations for CCDS 16057.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 60228930 60229082 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60229684 60229879 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60232200 60232367 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60233899 60234997 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60236754 60236926 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60240943 60241052 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60243557 60243670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60245212 60245260 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 60247890 60247909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2082 nt):
ATGGAGTCTAAACCTTCCAGGATTCCAAGAAGAATTTCTGTTCAACCCTCTGGCTCTTTAAGCACTAGGA
TG
GTGTCTGGAAACAGAGGAACCAGTTTAAATGATTCATATCATTCTAGAGACTCCTCCTTTAGACTGGA
T
TCTGAATATCAGTCTGCATCAGCATCAGCGTGTGCATCACCATGTCAGCCTGCCTGGTACAGTGAGTCT
GAG
ATACCTCAGGGAGCGCGGGCACGAGCACAGACCCAGCAGCGGGATCATGACTCAAAGAGACCCAAGC
TT
TCCTGTACAAACTGTGCATCTACCTCAGCTGGGAGGAACGGTGGGAGTGGGTTAAATACAGTGTCAGA
T
TCTTCTTGGAGGCATAGTCAAGTTCCCAGATCTTCATCAATGGTACTTGGTTCATTTGGAACAGACTTG
ATG
AGAGAAAGGAGAGATTTGGACAGGAGAAGAGAGTCCTCCATCAGCAATCTTATGGATTATAATCACC
GA
AGTGGTGATTTCACAACTTCATCATATGTTCAAGAAAGAGTTCCTTCTTCATATTCACAGGGAGCAAG
A
CCAAAAGAGAATGCAGTGAGCACTTTACAGTTGAATTCATCATCCACCAATCACCAATTGCCTTCTGAC
CAT
CAGACAGTACCAAGTTCTAGGGACTCCAGTAGAAGTTCTTTCAGATCACATTTTTCTCCAAGACAAT
CA
GAATCTTTTCGCAACAGTTCACATCCTGCATTTTCATATTTTTCAAGTAGAAATGAAACTCCAACTAT
A
AGCAATTCAGAAAGGGGTTCATCTCAGAGACCATATCGAGAATCTTCTGACAATGAAGGTAGGCGTACA
ACT
AGGAGATTGCTGTCACGGATAGCTTCTAGCATGTCATCTACTTTTTTCTCACGAAGATCTAGTCAAG
AT
TCCTTGAATACAAGATCTTTGAGTTCTGAAAATTATATTTCTCCGAGAACCCTGACTTCACAGTCTCG
G
AATAATGGAACCTCCTCGTCCTCTGACGTCAGTGAGGGCAGGGCAGCTGAAGCATCTCAGGGATTTAGA
TTT
CTTAGGCGAAGATGGGGGTTGTCGTCGCTCAGCCAAAATCATAGCTCTGAACCAGAGGCAGAAAATT
TT
AACCAAGAATCAGAAGGTAGAAATTCAGGACCATGGTTGTCTTCTTCACTTAGAAATAGATGCACACC
T
TTGTTCTCGAGAAGGAGGCGAGAGGGAAGGGATGAGTCTTCAAGAATGTCTACGTCAGATGTACCACCT
AGA
TCTCATATTTTCAGAAGAGATTCAAATGAAGTAGTTCATCTTGAAGCACAGGGTGACTCCCTTGGGG
CT
GCTGCCAACCGACCACAAGCATCTGGAGCGTCAAGCAGTGCTGCTGCAGGTGGCTCCACCCCAGAGTT
G
CCTCAGGGTGGAAGAAATCCAGGACTAACAGGGATTCTTCCTGGCTCCTTGTTCCGGTTTGCAGTCCCA
CCA
GCACTCGGCAGTAATCTGGCTGACAATGTCATGATTACTGTAGATATTATTCCTTCTGGTTGGAATT
CA
ACTGATGGGAAAAATGATAAAGCTAAAAGTGCACCTTCAAGAGACCCAGAAAAACTTCAGAAAATCAA
A
GAAAGCCTCCTTTTAGAGGACTCTGATGATGAAGAAGAAGGGGACTTATGTAGAATTTGTCAGATGGCA
GCA
GCGTCATCATCTAATTTATTGATAGAGCCGTGCAAATGCACAGGGAGCCTGCAGTACGTCCATCAAG
AG
TGTATGAAAAAGTGGTTACAAGCCAAAATTAATTCTGGCTCTTCATTAGAGGCTGTGACTACCTGTGA
A
CTCTGTAAAGAGAAGTTGCAACTTAACCTGGAGGATTTTGATATTCATGAACTACATAGAGCTCATGCA
AAT
GAACAAGCTGAGTATGAGTTTATCAGCTCTGGTCTCTACCTAGTTGTCTTACTGCACTTGTGTGAAC
AA
AGCTTTTCTGATATGATGGGAAATACAATTGAACCAAGCACTCGTGTCCGATTTATTAACCTTGCAAG
A
ACTCTTCAGGCACATATGGAAGATCTCGAAACTTCAGAGGATGAATTCTGA


Translation (693 aa):
MESKPSRIPRRISVQPSGSLSTRMVSGNRGTSLNDSYHSRDSSFRLDSEYQSASASACASPCQPAWYSES
E
IPQGARARAQTQQRDHDSKRPKLSCTNCASTSAGRNGGSGLNTVS
DSSWRHSQVPRSSSMVLGSFGTDL
M
RERRDLDRRRESSISNLMDYNHRSGDFTTSS
YVQERVPSSYSQGARPKENAVSTLQLNSSSTNHQLPSD
H
QTVPSSRDSSRSSFRSHFSPRQSESFRNSSHPAFSYFSSRNETPTISNSERGSSQRPYRESSDNEGRRT
T
RRLLSRIASSMSSTFFSRRSSQDSLNTRSLSSENYISPRTLTSQSRNNGTSSSSDVSEGRAAEASQGFR
F
LRRRWGLSSLSQNHSSEPEAENFNQESEGRNSGPWLSSSLRNRCTPLFSRRRREGRDESSRMSTSDVPP
R
SHIFRRDSNEVVHLEAQGDSLGAAANRPQASGASSSAAAGGSTPELPQGGRNPGLTGILPGSLFRFAVP
P
ALGSNLADNVMITVDIIPSGWNSTDGKNDKAKSAPSRDPEKLQKIKE
SLLLEDSDDEEEGDLCRICQMA
A
ASSSNLLIEPCKCTGSLQYVHQECMKKWLQAKINS
GSSLEAVTTCELCKEKLQLNLEDFDIHELHRAHA
N
EQ
AEYEFISSGLYLVVLLHLCEQSFSDMMGNTIEPSTRVRFINLARTLQAHMEDLETSEDEF



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser