NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS15770.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15770.1 Public Mus musculus 2 Entpd2 23 108 98 CCDS HistoryNCBI Gene:12496Re-query CCDS DB by CCDS ID:15770.1Re-query CCDS DB by GeneID:12496See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15770.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000028328.2 ENSMUSP00000028328.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028328.2Link to Ensembl Protein Viewer:ENSMUSP00000028328.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000028328Re-query CCDS DB by Protein ID:ENSMUSP00000028328
Original member Current member NCBI NM_009849.2 NP_033979.2 Accepted alive Link to Nucleotide Sequence:NM_009849.2Link to Protein Sequence:NP_033979.2Re-query CCDS DB by Nucleotide ID:NM_009849Re-query CCDS DB by Protein ID:NP_033979Link to BLAST:NP_033979.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033979.2 495 O55026-1 495 100% 0 0

Chromosomal Locations for CCDS 15770.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 25395973 25396089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 25397396 25397513 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 25398001 25398151 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 25398291 25398450 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 25398532 25398759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 25399282 25399536 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 25399617 25399736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 25400564 25400698 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 25400770 25400973 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1488 nt):
ATGGCTGGAAAGTTGGTGTCACTGGTGCCACCCCTGCTGCTGGCTGCCGTGGGCCTCGCCGGCCTCCTGC
TA
CTGTGCGTCCCTACCCAAGACGTCCGGGAGCCGCCCGCCCTCAAGTATGGCATCGTTCTGGATGCTGG
C
TCTTCACACACATCCATGTTTGTCTACAAGTGGCCAGCGGACAAGGAAAATGACACAGGTATCGTGGGC
CAG
CACAGCTCTTGCGATGTTCGAGGTGGTGGCATCTCCAGCTACGCAAATGACCCTTCTAGGGCAGGCC
AG
AGTCTGGTTGAATGTCTTGAACAGGCACTTCGGGATGTGCCCAAAGACAGATATGCCAGCACTCCACT
C
TACCTGGGAGCTACAGCAGGCATGCGCCTACTCAACCTGACCAGCCCAGAGGCCACAGCCAAGGTGCTG
GAG
GCAGTGACACAGACGCTCACACGGTACCCCTTTGACTTCCGTGGTGCCCGCATCCTCTCGGGACAGG
AT
GAAGGGGTGTTTGGCTGGGTGACTGCCAACTACCTGCTGGAGAACTTCATCAAGTATGGCTGGGTAGG
C
CGGTGGATACGGCCAAGGAAGGGAACTCTGGGGGCCATGGACCTTGGGGGTGCCTCAACACAGATCACC
TTT
GAGACAACCAGTCCATCTGAAGATCCAGATAATGAGGTCCATTTGCGGCTCTATGGCCAGCATTACC
GT
GTCTACACCCATAGCTTCCTCTGCTATGGCCGGGACCAGGTTCTCCAGAGGCTTCTGGCCAGTGCCCT
C
CAGATCCATCGCTTCCACCCCTGCTGGCCAAAGGGCTACTCCACCCAAGTGCTGCTCCGGGAAGTCTAC
CAG
TCTCCATGCACTATGGGTCAGCGTCCCCAGACCTTCAACAGCAGTGCCACTGTCAGCCTGTCAGGGA
CC
AGCAACGCTGCCCTCTGTCGTGACCTCGTCTCTGGGCTCTTCAATATCTCCTCCTGTCCCTTTTCCCA
A
TGCTCCTTCAATGGGGTTTTCCAGCCTCCCGTGGCTGGGAACTTCATAGCCTTTTCTGCTTTCTACTAT
ACT
GTAGACTTCCTGAAGACAGTGATGGGGCTGCCTGTGGGAACCCTGAAGCAGCTGGAGGATGCCACAG
AG
ACCACCTGCAACCAGACCTGGGCTGAGCTTCAGGCCCGAGTACCCGGACAGCAGACCCGCCTGCCTGA
C
TACTGCGCTGTAGCCATGTTCATACATCAGCTATTGAGCCGCGGTTATCGCTTCGACGAGCGCTCTTTC
CGT
GGAGTGGTCTTCGAAAAGAAGGCGGCAGACACGGCTGTCGGCTGGGCGCTGGGCTACATGCTGAATT
TG
ACCAACCTGATTCCCGCTGACCTCCCGGGACTACGTAAGGGCACCCACTTCAGCTCCTGGGTTGCTCT
C
CTGCTGCTCTTCACAGTCCTGATCTTGGCGGCTTTGGTCCTGCTCTTGCGCCAGGTGCGCTCTGCCAAG
TCC
CCAGGCGCCCTCTAG


Translation (495 aa):
MAGKLVSLVPPLLLAAVGLAGLLLLCVPTQDVREPPALKYGIVLDAGSSHTSMFVYKWPADKENDTGIVG
Q
HSSCDVR
GGGISSYANDPSRAGQSLVECLEQALRDVPKDRYASTPLYLGATAGMRLLNLTSPEATAKVL
E
AVTQTLTRYPFDFRGARILSGQDEGVFGWVTANYLLENFIK
YGWVGRWIRPRKGTLGAMDLGGASTQIT
F
ETTSPSEDPDNEVHLRLYGQHYRVYTHSFLCYGRDQVLQRLLASALQ
IHRFHPCWPKGYSTQVLLREVY
Q
SPCTMGQRPQTFNSSATVSLSGTSNAALCRDLVSGLFNISSCPFSQCSFNGVFQPPVAGNFI
AFSAFYY
T
VDFLKTVMGLPVGTLKQLEDATETTCNQTWAE
LQARVPGQQTRLPDYCAVAMFIHQLLSRGYRFDERSF
R
GVVFEKK
AADTAVGWALGYMLNLTNLIPADLPGLRKGTHFSSWVALLLLFTVLILAALVLLLRQVRSAK
S
PGAL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser