NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, May 21, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS15708.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15708.1 Public Mus musculus 2 Mllt10 23 108 98 CCDS HistoryNCBI Gene:17354Re-query CCDS DB by CCDS ID:15708.1Re-query CCDS DB by GeneID:17354See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15708.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000028076.14 ENSMUSP00000028076.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028076.14Link to Ensembl Protein Viewer:ENSMUSP00000028076.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000028076Re-query CCDS DB by Protein ID:ENSMUSP00000028076
Original member Current member EBI ENSMUST00000114680.8 ENSMUSP00000110328.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114680.8Link to Ensembl Protein Viewer:ENSMUSP00000110328.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000114680Re-query CCDS DB by Protein ID:ENSMUSP00000110328
Original member Current member NCBI NM_001252560.1 NP_001239489.1 Accepted alive Link to Nucleotide Sequence:NM_001252560.1Link to Protein Sequence:NP_001239489.1Re-query CCDS DB by Nucleotide ID:NM_001252560Re-query CCDS DB by Protein ID:NP_001239489Link to BLAST:NP_001239489.1
Original member Current member NCBI NM_010804.4 NP_034934.2 Accepted alive Link to Nucleotide Sequence:NM_010804.4Link to Protein Sequence:NP_034934.2Re-query CCDS DB by Nucleotide ID:NM_010804Re-query CCDS DB by Protein ID:NP_034934Link to BLAST:NP_034934.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001239489.1 1068 O54826 1068 100% 0 0
NP_034934.2 1068 O54826 1068 100% 0 0

Chromosomal Locations for CCDS 15708.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 18065035 18065194 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18071125 18071204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18101458 18101512 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18109782 18109891 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18122245 18122348 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18123719 18123812 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18126134 18126229 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18146777 18146872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18159456 18159711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18162317 18162886 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18170254 18170298 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18171043 18171075 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18186218 18186396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18196583 18196700 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18197925 18197997 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18203601 18203755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18206001 18206189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18206551 18206639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18206780 18207144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18207783 18207879 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18208750 18208947 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 18210768 18210812 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3207 nt):
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAAATGATTGGAG
GC
TGTTGCGTTTGCTCAGACGAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTG
C
AGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCTACTGGACCGTGGTTTTGTAGGAAA
TGT
GAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAGCTGTGTCCCCATAAAGATGGAGCTTTAAAAA
GA
ACAGATAATGGGGGTTGGGCTCATGTGGTTTGTGCCCTCTATATTCCAGAGGTACAATTTGCCAATGT
T
TCTACAATGGAGCCAATCGTTTTACAGTCTGTCCCACATGATCGTTATAATAAGACTTGCTATATATGT
GAT
GAACAAGGACGAGAAAGCAAAGCAGCCACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGAC
AG
GCTTTCCATGTAACATGTGCTCAGTTTGCCGGGCTGCTTTGTGAAGAAGAAGGGAATGGCGCAGACAA
T
GTTCAATACTGTGGCTACTGTAAATACCACTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCA
TATGAGCAAAGTTTAAGTGACTCTTCCTCTCACTCTCAGGATAAGCATCATGAGAAAGAGAAAAAAA
AA
TATAAAGAAAAGGACAAACACAAACAAAAACACAAGAAGCAACCAGAACCGTCACCTGCCTTGGTTCC
T
TCTTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCCATATCTGGATCATTGAAG
CGC
TTGGAAGATACTGCAGCAAGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCCCATACCTCTAGTG
GA
AAAGATGTTTCAGAGGCTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCA
A
AGGGGAAGGAAGCCTGGTGCAGGAAGAAATCCAGGAACAGCTGTGTCAGCATCTAGCCCCTTTCCACAA
G
GC
AGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGACT
TC
TTAAGCTTTACAGACTCAGATCTGCGAAGTGACAGTTACACTCACACCCAGCAGCCATCATCAACCAA
A
GATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGCGGCAGTAAACAGTTTTAGCTCTTTAGTTGGTCAC
CCT
GTGACCTCGACTGTTATTTCACAGCCTAAAAGCTTTGACAATTCACCTGGAGAGTTGGGTAGTTCGA
GC
CTCCCTACAGCAGGATATAAGCGGGCTCAGACTTCTGGTATAGAAGAAGAAGCTGTAAAGGAAAAGAA
A
CGAAAAGGAAATAAGCAAAGCAAACATGGCCCCGGCCGACCCAAAGGAAACAAAAATCAAGAAAATGTT
TCT
CACCTCTCAGTTTCTTCTGCTTCACCAACATCGTCCGTAGCATCAGCTGCAGGAAGTGTAACAAGCT
CT
AGTCTTCAGAAATCTCCTACGCTGCTCAGGAATGGAAGTTTGCAGAGTCTTAGTGTTGGCTCGTCTCC
A
GTTGGCTCAGAAATTTCCATGCAGTATCGACATGATGGAGCTTGTCCAACAACTACCTTCTCAGAGTTG
CTG
AATGCAATACACAATGGTATTTATAACAGCAATGATGTAGCCGTATCCTTTCCAAACGTGGTGTCTG
GC
TCAGGATCTAGTACTCCTGTCTCTAGCTCTCATATACCTCAGCAGTCATCTGGTCATTTGCAACAGGT
G
GGAGCTCTCTCCCCCTCAGCTGCGTCATCTGTAACCCCTGCTGCTGCTACAACTCAGGCAAATACCGTT
TCT
GGATCTTCTCTCAGTCAGGCACCAGCCCATATGTATGGCAGTAGATTAAATCAGAATCCATCCATGG
CA
GTTCTCATAGCTCAGTCTGAAAGCAGCCAAACAGATCAAGATCTTGGAGACAATGCCCGTAGCCTGGG
T
GGCCGAGGAAGCTCGCCCCGAGGAAGCCTCTCTCCGAGATCCCCTGTGAGCAACTTACAGCTTCGCTAT
GAT
CAACCGAGCAATAGCAGTTTGGAAACTGTGCCTCCAGTAGCAGCAAGTATTGAACAGCTCTTGGAGA
GG
CAGTGGAGTGAAGGACAGCAGTTTTTACTAGAGCAGGGGACTCCTGGTGACATTCTAGGAATGTTAAA
G
TCATTACATCAACTTCAAGTTGAAAATCGAAGATTAGAAGAACAGATCAAAAATTTGACTGCCAAGAAA
GAA
CGTCTTCAGTTGTTGAATGCACAGCTTTCAGTGCCTTTCCCAGCCATAACGACAAACCCCAGTCCGT
CC
CATCAGATGCACACATACACAGCACAGACTGCTCCTCCTCCTGATTCCCTGAACAGCAGTAAGAGCCC
A
CATATAGGAAACAGCTTTTTACCTGACAATTCTCTTCCTGTATTAAATCAGGACTTGACCTCCAGTGGA
CAA
AGCACCAGCAGTTCTTCTGCTCTTTCTACTCCCCCTCCTGCTGGCCAGAGTCCTGCTCAGCAGAGCT
CT
GGAGTCAGTGGGGTTCAGCAGGTGAATGGCGTGACAGTGGGGGCACTAGCTAGTGGGATGCAGACCGT
C
ACATCCACCATCCCAGCTGTGTCCGCAGTGGGTGGAATAATTGGAGCTCTGCCAGGTAACCAACTGGCA
ATT
AACGGCATTGTGGGAGCTTTAAATGGTGTGATTCAGACTCCAGTCACAATCTCCCAGAACCCTGCCC
CT
CTCACCCACACCAGTGTACCACCTAATGCAGCGCATCCAATGCCGGCCGCCGCACTGACCAACAGTGC
C
TCGGGACTAGGGCTGCTGTCGGACCAGCAGAGACAGATGTTTATCCAGCAGCAGCAGTTCCAGCAGCTG
TTA
AACTCCCAGCAGCTCACACCCGAACAGCATCAGGCCTTCCTATACCAGCTGATGCAGCAGCAGCACC
AC
CCGCCTGAGCTCCAGCAGCTGCAGCTCCCGGGACCCACGCAGATCCCCATCAACAATCTCCTTGCAGG
T
GCTCAGGCGCCTCCACTCCACACAGCTACCACCAACCCCTTCCTCACCATCCACGGGGACAGCACGAGC
CAG
AAGGTCACAAGACTTAGTGATAAAACTGGGCCTGTAGCTCAAGAGAAAAGTTGA


Translation (1068 aa):
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVPTGPWFCRK
C
ESQERAARV
RCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTMEPIVLQSVPHDRYNKTCYIC
D
EQGRESKAATGACMTCNKHGCRQAFHVT
CAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNR
S
YEQSLSDSSSHSQDKHHEKEKK
KYKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTYTSTSNNSISGSLK
R
LEDTAARFTNANFQEVSAHTSSGKDVSEARGSEGKGKKSSAHSSGQRGRKPGAGRNPGTAVSASSPFPQ

G
SFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRSDSYTHTQQPSSTKDVHKGESGSQEAAVNSFSSLVGH
P
VTSTVISQPKSFDNSPGELGSSSLPTAGYKRAQTSGIEEEAVKEKKRKGNKQSKHGPGRPKGNKNQENV
S
HLSVSSASPTSSVASAAGSVTSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQYRHDGACPTTTFSEL
L
NAIHN
GIYNSNDVAVSFPNVVSGSGSSTPVSSSHIPQQSSGHLQQVGALSPSAASSVTPAAATTQANTV
S
GSSLSQAPAHMYGSRLNQNPSMAVLIAQSESSQT
DQDLGDNARSLGGRGSSPRGSLSPRSPVSNLQLRY
D
QPSNSSLETVPPVAASIEQLLERQWSEGQQFLLEQGTPGD
ILGMLKSLHQLQVENRRLEEQIKNLTAKK
E
RLQLLNAQLSVPFPAITTNPSPSHQMHTYTAQT
APPPDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSG
Q
STSSSSALSTPPPAGQSPAQQSSGVSGVQQVNGVTVGALASGMQTVTSTIPAVSAVGGIIGALPGNQLA
I
NGIVGALNGVIQTPVTISQNPAPLTHTSVPPNAAHPMPAAALTN
SASGLGLLSDQQRQMFIQQQQFQQL
L
NSQQLTP
EQHQAFLYQLMQQQHHPPELQQLQLPGPTQIPINNLLAGAQAPPLHTATTNPFLTIHGDSTS
Q
KVT
RLSDKTGPVAQEKS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser